KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100411734Help
Entry
100411734         CDS       T03264                                 

Gene name
SETDB1
Definition
(RefSeq) SET domain bifurcated 1
  KO
K11421  histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
cjc00310  Lysine degradation
cjc04550  Signaling pathways regulating pluripotency of stem cells
Brite
KEGG Orthology (KO) [BR:cjc00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100411734 (SETDB1)
 Cellular Processes
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100411734 (SETDB1)
Enzymes [BR:cjc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100411734 (SETDB1)
Chromosome [BR:cjc03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100411734 (SETDB1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100411734 (SETDB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET MBD DUF4537 53-BP1_Tudor
Motif
Other DBs
NCBI-GeneID: 100411734
NCBI-ProteinID: XP_008982555
Ensembl: ENSCJAG00000006972
UniProt: U3DWM7
LinkDB All DBs
Position
18
AA seq 1296 aa AA seqDB search
MSSLPGRIGLDAATATVESEEIKELQQAVVEELGISMEELRHFIDEELEKMDCVQQRKKQ
LAELETWVIQKESEVAHVDQLFDDASRAVTNCESLVKDFYSKLGLQYRDSSSEDESSRPT
EIIEIPDEDDDVLSIDSGDAGNRTPKDQKLREAMAALRKSAQDVQKFMDAVNKKSSSQDL
HKGTLSPMSGELSKDGDLIVSMRILGKKRTKTWHKGTLIAIQTVGPGKKYKVKFDNKGKS
LLSGNHIAYDYHPPADKLFVGSRVVAKYKDGNQVWLYAGIVAETPNVKNKLRFLIFFDDG
YASYVTQSELYPICRPLKKTWEDIEDISCRDFIEEYVTAYPNRPMVLLKSGQLIKTEWEG
TWWKSRVEEVDGSLVRILFLDDKRCEWIYRGSTRLEPMFSMKTSSASALEKKQGGQLRTR
PNMGAVRSKGPVVQYTQDLTGTGTQFKPVEPPQPTAPPAPPFPPAPPLSPQAGDSESLES
QLAQSRKQVAKKSTSFRPGSVGSGHSSPTSPALSENVSGGKPGINQTYRSPLGSTASAPA
PSAPPAPPAPPAPPAFHGMLERAPAEPSYRAPMEKLFYLPHVCSYTCLSRIRPMRNEQYR
GKNPLLVPLLYDFRRMTARRRVNRKMGFHVIYKTPCGLCLRTMQEIERYLFETGCDFLFL
EMFCLDPYVLVDRKFQPYKPFYYILDITYGKEDVPLSCVNEIDTTPPPQVAYSKERIPGK
GVFINTGPEFLVGCDCKDGCRDKSKCACHQLTIQATACTPGGQINPNSGYQYKRLEECLP
TGVYECNKRCNCDPNMCTNRLVQHGLQVRLQLFKTQNKGWGIRCLDDIAKGSFVCIYAGK
ILTDDFADKEGLEMGDEYFANLDHIESVENFKEGYESDAPCSSDSSGVDLKDQEDGNSGT
EDPEESNDDSSDDNFCKDEDFSTSSVWRSYATRRQTRGQKENGLSETVSKDSRPPDLGPP
HIPVPPSIPIGGCNPPSSEETPKNKVASWLSCNSVSEGGFADSDSHSSFKTNEGGDGRAG
GSRMEAEKASTSGLGIKDEGDIKQAKKEDPDDRNKMSVVTESSRNYGYNPSPVKPEGLRR
PPSKTSMHQSRRLLASAQSNPDDVLTLSSSTESEGESGTSRKPTAGQTSATAVDSDDIQT
ISSGSEGDDFEDKKNMTGPMKRQVAVKSTRGFALKSTHGIAIKSTNMASVDKGESAPVRK
NTRQFYDGEESCYIIDAKLEGNLGRYLNHSCSPNLFVQNVFVDTHDLRFPWVAFFASKRI
RAGTELTWDYNYEVGSVEGKELLCCCGAIECRGRLL
NT seq 3891 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcccttcctgggcgcattggtttggatgcagcaacagctacagtggagtctgaa
gagatcaaagagctgcaacaggcagtggttgaggaactgggtatctctatggaagaactt
cggcatttcatcgatgaggaactggagaagatggattgtgtacagcagcgcaagaaacag
ctagcagagttagagacatgggtgatacagaaagaatctgaggtggctcatgttgaccag
ctctttgatgatgcatctagggcagtgactaattgtgagtctttggtgaaggacttctac
tccaagctgggactacaataccgggacagtagctctgaggatgaatcttcccggcctaca
gaaataattgagattcctgatgaagacgatgatgtcctcagtattgattcaggtgatgct
gggaacagaactccaaaagaccagaagctccgtgaagctatggctgccttaagaaagtca
gctcaagatgttcagaagttcatggatgctgttaacaagaagagtagttcccaggatctg
cataaaggaaccttgagtccgatgtctggagaactaagcaaagatggtgacctgatagtc
agcatgcgaattctgggcaagaagagaactaagacatggcacaaaggcacccttattgcc
atccagacagttgggccagggaagaagtacaaggtgaaatttgacaacaaaggaaagagt
ctactgtcggggaaccatattgcctatgattaccaccctcctgctgacaagctgtttgtg
ggcagtcgggtggtcgccaaatacaaagatgggaatcaggtctggctctatgctggcatt
gtagctgagacaccaaacgtcaaaaacaagctcaggtttctcattttctttgatgatggc
tatgcttcctatgtcacacagtctgaactgtatcccatttgccggccactgaaaaagact
tgggaggacatagaagacatctcctgtcgtgacttcatagaggagtatgtcactgcctac
cccaaccgccccatggtactgctcaagagtggccagcttatcaagactgagtgggaaggc
acatggtggaagtcccgagttgaggaggtggatggcagcctagtcaggatcctcttcctg
gatgacaaaagatgtgagtggatctatcgaggctctacacggctggagcccatgttcagc
atgaaaacatcctcagcctctgcactggagaagaagcaaggaggacagctcaggacacgt
ccaaacatgggtgctgtgaggagcaaaggccctgttgtccaatacacacaggatctgact
ggtactggaacccagttcaagccagtggaacccccacagcctacagctccacctgcccca
cctttcccacctgctccacctctgtccccccaagcaggtgacagtgaaagtttggaaagc
cagcttgcccagtcacggaaacaggtagccaaaaagagcacatccttccgaccaggatct
gtgggctctggtcattcctcccctacctctcctgcactcagtgaaaatgtctctggtggc
aaacctgggatcaaccagacatacagatcacctttaggctccacagcctctgccccagca
ccctcagcacccccagcacccccagcccctccagcacccccagccttccatggcatgctg
gagcgggccccagcagagccctcctaccgtgctcccatggagaagcttttctacttacct
catgtctgcagctatacctgtctgtctcgaatcagacctatgaggaatgagcagtaccgg
ggcaagaaccctctgctggtcccattactatatgactttcggcggatgacggcccggcgt
cgagttaaccgcaagatgggctttcatgttatctataagacaccttgtggtctgtgcctt
cggacaatgcaggagatcgaacgctacctttttgagactggctgtgacttcctcttcctg
gagatgttctgtttggatccatacgttcttgtggaccgcaagtttcagccctataagcct
ttttactatatcttagacatcacctatgggaaggaagatgttcccctatcctgtgttaac
gaaattgacacaacccctccaccccaggtggcctacagcaaggaacgtatcccgggcaag
ggtgttttcattaacacaggccctgaatttctggttggctgtgactgcaaggatgggtgt
cgggacaagtccaagtgtgcctgccatcagctaactatccaggctacagcctgtacccca
ggaggccaaatcaaccctaactctggctaccagtacaagagattagaagagtgtctgccc
acaggagtatatgagtgtaacaaacgctgcaattgtgacccaaacatgtgcacaaaccgg
ttggtacaacatggactgcaagttcggctacagctgttcaagacacagaacaagggctgg
ggtatccgctgcttggatgacattgccaagggctcttttgtctgtatttatgcaggcaaa
atcctgacagatgactttgcagacaaagagggtctggaaatgggtgatgagtactttgca
aatctggatcatatcgagagtgtggagaacttcaaagaaggatatgagagtgatgccccc
tgttcctctgacagcagtggtgtagacttgaaggaccaggaagatggcaacagcggtaca
gaggaccctgaagagtctaacgacgatagctcagatgataacttctgtaaggatgaggac
ttcagcaccagttcagtatggcggagctatgctacccggaggcagacccggggccagaaa
gagaacggactctctgagacagtttccaaggactcccgccccccagatcttggaccccca
catattcctgttcctccctcaatccctataggtggctgtaatccaccttcctctgaagag
acacccaagaacaaggtggcctcatggttgagctgcaatagtgtcagtgaaggtggtttt
gctgactctgatagccattcatccttcaagaccaatgaaggtggggacggccgggctggg
ggaagccgaatggaggctgagaaggcctccacctcaggactgggcatcaaggatgagggc
gacatcaagcaggccaagaaagaggaccctgacgaccgaaacaagatgtcagtagttact
gaaagctctcgaaattatggttacaatccttctcccgtgaaacctgaaggacttcgccgc
ccacctagtaagactagtatgcatcaaagccgacgactcctggcttctgctcagtccaac
cctgatgatgtcctgacactgtccagcagcacagaaagtgagggggaaagtgggaccagc
cgaaagcccactgctggtcagacttcagctacggcggttgacagtgatgatatccagacc
atctcctctggctctgaaggggatgactttgaggacaagaagaacatgactggtccaatg
aagcgtcaagtggcagtaaaatccacccgaggctttgctcttaaatcaacccatgggatt
gcaattaaatcaaccaacatggcttctgtggacaagggggagagtgcacctgttcgtaag
aacacacgccaattctacgatggcgaggagtcctgctacatcattgatgccaagctggaa
ggcaatctgggacgctacctcaaccacagctgcagccccaacctgtttgtccagaatgtc
ttcgtggatacgcatgatcttcgcttcccctgggtggccttctttgccagcaaaagaatc
cgggccgggacagaacttacttgggactacaactacgaggtgggcagtgtggaaggcaag
gagctgctctgttgctgtggggccattgaatgcagaggacgtcttctttag

DBGET integrated database retrieval system