KEGG   Callithrix jacchus (white-tufted-ear marmoset): 100414548Help
Entry
100414548         CDS       T03264                                 

Gene name
KMT5A, SETD8
Definition
(RefSeq) lysine methyltransferase 5A
  KO
K11428  
histone-lysine N-methyltransferase SETD8 [EC:2.1.1.43]
Organism
cjc  Callithrix jacchus (white-tufted-ear marmoset)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:cjc00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100414548 (KMT5A)
Enzymes [BR:cjc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100414548 (KMT5A)
Chromosome [BR:cjc03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100414548 (KMT5A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
LinkDB All DBs
Position
9
AA seq 343 aa AA seqDB search
MLVDEAAAAAAAVAATAPGPEMVERRGPGRPRTDGENVFIGQSKIYSYMSPNKCSGMRFP
LQEENSVTHHEVKCQGKPLAGICRKREEKRNAGNAVRSTMKSEEQKIKDARRGPLAPFPN
QKSEAAEPPKTPPSSCDSANAAVAKQALKKPIKGKQAPRKKAQGKTQQNRKLTDFYPVRR
SSRKSKAELQSEERKRIDELIESGKEEGMKIDLIDGKGRGVIATKQFSRGDFVVEYHGDL
IEITDAKKREALYAQDPSTGCYMYYFQYLSKTYCVDATRETNRLGRLINHSKCGNCQTKL
HDIDGVPHLILIASRDIAAGEELLYDYGDRSKASIEAHPWLKH
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgctcgtagatgaggcggcggcggcggcggcggcggtggcagcgacggccccgggcccg
gagatggtggagcggaggggcccggggaggccccgcaccgacggggagaatgtatttatc
gggcagtcaaagatctattcctacatgagcccgaacaaatgctctggaatgcgtttcccc
cttcaggaagagaactcagttacacatcacgaagtcaaatgccaggggaaaccattagcc
ggaatctgcagaaaacgagaagagaaaaggaatgctgggaacgcagtacggagcaccatg
aagtccgaggaacagaagatcaaagatgccaggagaggtcccctggcaccttttccaaac
caaaaatctgaagcagcagaacctccaaaaactccaccctcgtcttgtgattccgccaat
gcagctgtcgccaagcaagccctgaaaaagcccatcaagggcaaacaggccccccgaaaa
aaagctcaaggaaaaacacaacagaatcgcaaacttacggatttctaccccgtccgaagg
agctccaggaagagcaaagctgaactgcagtctgaagaaaggaaaagaatagatgaattg
attgaaagtgggaaggaagaaggaatgaagattgacctcatcgatggcaaaggcaggggt
gtgattgccacaaagcagttctctcggggtgactttgtggtggaataccacggggacctc
attgagatcactgacgctaagaagcgggaggctctgtacgcacaggacccttccacgggc
tgctacatgtactattttcagtatctgagcaaaacctactgcgtggatgcaactagagag
acaaatcgcctaggaagactgatcaatcacagcaaatgtgggaactgccagaccaaactg
cacgacatcgacggtgtacctcacctcatcctcatcgcctcccgagacatcgcggctggg
gaggagctcctgtacgactatggggaccgcagcaaggcttccatcgaagcccacccatgg
ctgaagcattaa

DBGET integrated database retrieval system