KEGG   Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819: Cj0470Help
Entry
Cj0470            CDS       T00026                                 

Gene name
tuf
Definition
(RefSeq) elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
cje  Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819
Brite
Translation factors [BR:cje03012]
 Eukaryotic Type
  Elongation factors
   Cj0470 (tuf)
 Prokaryotic Type
   Cj0470 (tuf)
Mitochondrial biogenesis [BR:cje03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Cj0470 (tuf)
Exosome [BR:cje04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Cj0470 (tuf)
  Exosomal proteins of breast cancer cells
   Cj0470 (tuf)
  Exosomal proteins of colorectal cancer cells
   Cj0470 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
GeneDB: 
UniProt: 
LinkDB All DBs
Position
434408..435607
Genome map
AA seq 399 aa AA seqDB search
MAKEKFSRNKPHVNIGTIGHVDHGKTTLTAAISAVLSRRGLAELKDYDNIDNAPEEKERG
ITIATSHIEYETDNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLSRQVGVPYIVVFMNKADMVDDAELLELVEMEIRELLSSYDFPGDDTPIISGSALKALE
EAKAGQDGEWSAKIMDLMAAVDSYIPTPTRDTEKDFLMPIEDVFSISGRGTVVTGRIEKG
VVKVGDTIEIVGIKDTQTTTVTGVEMFRKEMDQGEAGDNVGVLLRGTKKEEVIRGMVLAK
PKSITPHTDFEAEVYILNKDEGGRHTPFFNNYRPQFYVRTTDVTGSIKLADGVEMVMPGE
NVRITVSLIAPVALEEGTRFAIREGGKTVGSGVVSKIIK
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagaaaaattttcacgtaataagccacacgtaaatattggtactattggtcat
gttgaccatggtaaaactactttaacagctgctatttctgctgttctttctagaagaggt
ttagcagagcttaaagattatgataatatcgataatgctccagaagaaaaagagcgtggt
attactattgctacttctcatattgaatatgaaacagacaatcgtcactatgcacacgtt
gactgcccaggtcacgcagattatgttaaaaacatgattacaggtgctgcacaaatggat
ggagcgatcttggttgtttctgctgcagatggccctatgccacaaactagagagcacatt
cttctttctcgtcaagtaggcgttccatatattgttgtttttatgaataaagcagatatg
gttgatgatgctgaacttttagagttagttgaaatggaaattagagaattattaagctct
tatgatttcccaggcgatgatacacctattatttctggttctgctttaaaagctcttgaa
gaagctaaagctggacaagatggtgaatggtcagcaaaaattatggatcttatggctgca
gttgatagctatattccaactccaactcgtgatactgaaaaagacttcttgatgccaatt
gaagatgttttctcaatttcaggtcgtggtactgttgttacaggtagaattgaaaaaggt
gttgtaaaagtaggtgatactatcgaaatcgttggtattaaagatactcaaacaacaact
gtaacaggtgttgaaatgttcagaaaagaaatggatcaaggcgaagcaggagataacgta
ggtgttcttcttcgtggtactaaaaaagaagaagttatccgtggtatggttcttgctaaa
ccaaaatcaattactccacacactgacttcgaagctgaagtttatatcttaaataaagat
gaaggtggtagacatactccattctttaacaactatagaccacagttttatgtaagaaca
actgatgttacaggttcgattaaattagctgatggtgttgaaatggttatgccaggtgaa
aatgtgagaattactgtaagcttgatcgctccagtagcacttgaagaaggaactcgtttt
gctattcgtgaaggtggtaaaactgttggttcaggtgttgtttctaaaattattaaataa

DBGET integrated database retrieval system