KEGG   Campylobacter jejuni subsp. jejuni 00-2544: N755_00505Help
Entry
N755_00505        CDS       T02843                                 

Gene name
tuf
Definition
(GenBank) elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
cjen  Campylobacter jejuni subsp. jejuni 00-2544
Brite
Translation factors [BR:cjen03012]
 Eukaryotic Type
  Elongation factors
   N755_00505 (tuf)
 Prokaryotic Type
   N755_00505 (tuf)
Mitochondrial biogenesis [BR:cjen03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    N755_00505 (tuf)
Exosome [BR:cjen04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   N755_00505 (tuf)
  Exosomal proteins of breast cancer cells
   N755_00505 (tuf)
  Exosomal proteins of colorectal cancer cells
   N755_00505 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
LinkDB All DBs
Position
473302..474501
Genome map
AA seq 399 aa AA seqDB search
MAKEKFSRNKPHVNIGTIGHVDHGKTTLTAAISAVLSRRGLAELKDYDNIDNAPEEKERG
ITIATSHIEYETDNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLSRQVGVPYIVVFMNKADMVDDAELLELVEMEIRELLSSYDFPGDDTPIISGSALKALE
EAKAGQDGEWSAKIMDLMAAVDSYIPTPTRDTEKDFLMPIEDVFSISGRGTVVTGRIEKG
VVKVGDTIEIVGIKDTQTTTVTGVEMFRKEMDQGEAGDNVGVLLRGTKKEEVIRGMVLAK
PKSITPHTDFEAEVYILNKDEGGRHTPFFNNYRPQFYVRTTDVTGSIKLADGVEMVMPGE
NVRITVSLIAPVALEEGTRFAIREGGKTVGSGVVSKIIK
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagaaaaattttcacgtaataagccacacgtaaatattggtactattggtcat
gttgaccatggtaaaactactttaacagctgctatttctgctgttctttctagaagaggt
ttagcagagcttaaagattatgataatatcgataatgctccagaagaaaaagagcgtggt
attactattgctacttctcatattgaatatgaaacagacaatcgtcactatgcacacgtt
gactgcccaggtcacgcagattatgttaaaaacatgattacaggtgctgcacaaatggat
ggagcgatcttggttgtttctgctgcagatggccctatgccacaaactagagagcacatt
cttctttctcgtcaagtaggcgttccatatattgttgtttttatgaataaagcagatatg
gttgatgatgctgaacttttagagttagttgaaatggaaattagagaattattaagctct
tatgatttcccaggcgatgatacacctattatttctggttctgctttaaaagctcttgaa
gaagctaaagctggacaagatggtgaatggtcagcaaaaattatggatcttatggctgca
gttgatagctatattccaactccaactcgtgatactgaaaaagacttcttgatgccaatt
gaagatgttttctcaatttcaggtcgtggtactgttgttacaggtagaattgaaaaaggt
gttgtaaaagtaggtgatactatcgaaatcgttggtattaaagatactcaaacaacaact
gtaacaggtgttgaaatgttcagaaaagaaatggatcaaggcgaagcaggagataacgta
ggtgttcttcttcgtggtactaaaaaagaagaagttatccgtggtatggttcttgctaaa
ccaaaatcaattactccacacactgacttcgaagctgaagtttatatcttaaataaagat
gaaggtggtagacatactccattctttaacaactatagaccacagttttatgtaagaaca
actgatgttacaggttcgattaaattagctgatggtgttgaaatggttatgccaggtgaa
aatgtgagaattactgtaagcttgatcgctccagtagcacttgaagaaggaactcgtttt
gctattcgtgaaggtggtaaaactgttggttcaggtgttgtttctaaaattattaaataa

DBGET integrated database retrieval system