KEGG   Campylobacter jejuni subsp. jejuni IA3902: CJSA_0440Help
Entry
CJSA_0440         CDS       T01854                                 

Gene name
tuf
Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
cji  Campylobacter jejuni subsp. jejuni IA3902
Brite
Translation factors [BR:cji03012]
 Eukaryotic Type
  Elongation factors
   CJSA_0440 (tuf)
 Prokaryotic Type
   CJSA_0440 (tuf)
Mitochondrial biogenesis [BR:cji03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CJSA_0440 (tuf)
Exosome [BR:cji04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CJSA_0440 (tuf)
  Exosomal proteins of breast cancer cells
   CJSA_0440 (tuf)
  Exosomal proteins of colorectal cancer cells
   CJSA_0440 (tuf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW
Motif
Other DBs
NCBI-ProteinID: ADC28089
LinkDB All DBs
Position
439059..440258
Genome map
AA seq 399 aa AA seqDB search
MAKEKFSRNKPHVNIGTIGHVDHGKTTLTAAISAVLSRRGLAELKDYDNIDNAPEEKERG
ITIATSHIEYETDNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLSRQVGVPYIVVFMNKADMVDDAELLELVEMEIRELLSSYDFPGDDTPIISGSALKALE
EAKAGQDGEWSAKIMDLMAAVDSYIPTPTRDTEKDFLMPIEDVFSISGRGTVVTGRIEKG
VVKVGDTIEIVGIKDTQTTTVTGVEMFRKEMDQGEAGDNVGVLLRGTKKEEVIRGMVLAK
PKSITPHTDFEAEVYILNKDEGGRHTPFFNNYRPQFYVRTTDVTGSIKLADGVEMVMPGE
NVRITVSLIAPVALEEGTRFAIREGGKTVGSGVVSKIIK
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagaaaaattttcacgtaataagccacacgtaaatattggtactattggtcat
gttgaccatggtaaaactactttaacagctgctatttctgctgttctttctagaagaggt
ttagcagagcttaaagattatgataatatcgataatgctccagaagaaaaagagcgtggt
attactattgctacttctcatattgaatatgaaacagacaatcgtcactatgcacacgtt
gactgcccaggtcacgcagattatgttaaaaacatgattacaggtgctgcacaaatggat
ggagcgatcttggttgtttctgctgcagatggccctatgccacaaactagagagcacatt
cttctttctcgtcaagtaggcgttccatatattgttgtttttatgaataaagcagatatg
gttgatgatgctgaacttttagagttagttgaaatggaaattagagaattattaagctct
tatgatttcccaggcgatgatacacctattatttctggttctgctttaaaagctcttgaa
gaagctaaagctggacaagatggtgaatggtcagcaaaaattatggatcttatggctgca
gttgatagctatattccaactccaactcgtgatactgaaaaagacttcttgatgccaatt
gaagatgttttctcaatttcaggtcgtggtactgttgttacaggtagaattgaaaaaggt
gttgtaaaagtaggtgatactatcgaaatcgttggtattaaagatactcaaacaacaact
gtaacaggtgttgaaatgttcagaaaagaaatggatcaaggcgaagcaggagataacgta
ggtgttcttcttcgtggtactaaaaaagaagaagttatccgtggtatggttcttgctaaa
ccaaaatcaattactccacacactgacttcgaagctgaagtttatatcttaaataaagat
gaaggtggtagacatactccattctttaacaactatagaccacagttttatgtaagaaca
actgatgttacaggttcgattaaattagctgatggtgttgaaatggttatgccaggtgaa
aatgtgagaattactgtaagcttgatcgctccagtagcacttgaagaaggaactcgtttt
gctattcgtgaaggtggtaaaactgttggttcaggtgttgtttctaaaattattaaataa

DBGET integrated database retrieval system