KEGG   Coturnix japonica (Japanese quail): 107307203Help
Entry
107307203         CDS       T04297                                 

Gene name
SUV39H1
Definition
(RefSeq) suppressor of variegation 3-9 homolog 1
  KO
K11419  histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
cjo  Coturnix japonica (Japanese quail)
Pathway
cjo00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:cjo00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    107307203 (SUV39H1)
Enzymes [BR:cjo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     107307203 (SUV39H1)
Chromosome and associated proteins [BR:cjo03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107307203 (SUV39H1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    107307203 (SUV39H1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET Chromo Diacid_rec
Motif
Other DBs
NCBI-GeneID: 107307203
NCBI-ProteinID: XP_015706163
LinkDB All DBs
Position
Un
AA seq 412 aa AA seqDB search
MAENLKGCSVRCKSTWLQLQELCRARGLRCAALGVTRRNLVEFEVEYLCDYKRSGGDEFY
LVKWRGYPDSANTWEPRKNLRCRGLLKQLHQDLARAPGGPVRPGPRGLPPRVSSYLVQKA
EQRQALRRWEQQLNSTRSHRGRIAVENEVDLHGPPRDFVYINEYKVGAGIQLTPVAVGCE
CSDCMAEAAGGCCPGASHNKFAYNEAGLVRIRAGLPIYECNSRCRCGSECPNRVVQKGIR
YNLCIFRTGNGRGWGVRTMERIRKNSFVMEYIGEIITSEEAERRGQVYDRQGATYLFDLD
YVEDVYTVDAAHYGNISHFVNHSCDPNLQVYNVFIENLDERLPRIALFATRPIRAGEELT
FDYNMHVDPVDAESTRMDSNFGLAGGALSSSPRSRGRIECKCGAAACRKYLF
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaaatttaaaaggctgctcggtgcgctgtaaatcgacgtggctgcagctgcag
gagctgtgccgggcccgggggctgcgctgcgccgcgctcggcgtcacccgcaggaacctg
gtggagttcgaggtggaatatttgtgtgactacaaacggagcgggggtgatgagttctac
ctggtgaagtggcgggggtacccggacagcgccaacacctgggagccccgcaagaacctg
cgctgccgggggctgctcaagcagctgcaccaggacctggcgcgtgccccgggggggccg
gtgagacccggaccccgaggtttgcccccccgcgtctcctcgtacctggtgcagaaggcg
gagcagcgtcaggcgctgcggcgctgggagcagcagctcaacagcacccgcagccatcga
ggccgcatcgccgtagagaacgaggtggacttgcacggccccccccgggacttcgtctac
atcaacgagtacaaagtgggggctgggatccagctgacccccgtggccgtgggctgcgag
tgcagcgactgcatggccgaggcggcgggcggctgctgccccggggcctcgcacaataag
ttcgcctacaacgaggccgggttggtgcgaatccgggccgggctgcccatctatgagtgc
aactccaggtgccgctgtggctccgagtgccccaaccgcgtggtgcagaaggggattcgc
tacaacctctgcatcttccgcaccggcaacgggagaggatggggagtgagaaccatggag
cgcatccgcaagaacagcttcgtgatggagtacatcggggagatcatcacctcggaggag
gccgagcgccgcgggcaggtgtacgaccgtcagggcgccacgtacctgttcgacctggac
tacgtggaggacgtgtacaccgtggatgccgcccactacgggaacatctcccacttcgtc
aaccacagctgcgaccccaacctgcaggtctacaatgtcttcattgagaacctggacgag
cgcctgccccgcatcgccctctttgccacccggcccatccgcgctggcgaggagctcacg
ttcgactacaacatgcacgtggacccggtggacgcagagagcacccgcatggactccaac
tttggactggccgggggggccctgagcagctccccccgctcccggggccgcattgagtgc
aaatgtggggctgccgcctgccgcaagtacctcttctga

DBGET integrated database retrieval system