KEGG   Coturnix japonica (Japanese quail): 107311513Help
Entry
107311513         CDS       T04297                                 

Gene name
SOD2
Definition
(RefSeq) superoxide dismutase 2
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cjo  Coturnix japonica (Japanese quail)
Pathway
cjo04068  FoxO signaling pathway
cjo04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:cjo00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    107311513 (SOD2)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    107311513 (SOD2)
Enzymes [BR:cjo01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     107311513 (SOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 107311513
NCBI-ProteinID: XP_015713531
LinkDB All DBs
Position
3
AA seq 241 aa AA seqDB search
MDVGRKWILENEICRDVRKRTQMEQKESRAALVAPLGCSVARQKHTLPDLPYDYGALEPH
ISAEIMQLHHSKHHATYVNNLNVTEEKYKEALAKGDVTAQVSLQPALKFNGGGHINHTIF
WTNLSPNGGGEPKGELMEAIKRDFGSFANFKEKLTAVSVGVQGSGWGWLGYNKEQGRLQI
AACANQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKAIWNVINWENVSSRYASCK
K
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atggatgttgggagaaaatggatattggaaaatgagatatgcagagacgtgagaaagaga
actcaaatggaacaaaaagagagcagggctgcgctggtagcgcctttggggtgctcggtc
gcaaggcagaagcacactctgcctgacctaccgtacgactatggagcgctggagccacac
atcagtgctgagatcatgcagctgcaccacagcaaacaccacgccacctacgtgaacaac
ctgaatgttacagaggagaaatacaaagaggcgctggcaaaaggtgatgttacagctcag
gtgtcgcttcagcctgcactgaaattcaatggtgggggtcatatcaatcataccatcttc
tggacaaatctttctcccaatggaggaggagagcctaaaggagaattgatggaagccatc
aaacgtgacttcggttctttcgcaaacttcaaggagaaactaacagctgtatcagttggt
gttcaaggatcaggctgggggtggcttggctataataaggaacagggacgtctacagata
gcagcctgtgcaaatcaagatcctttgcaaggaacaacaggtctcattccattgctggga
attgatgtatgggaacatgcctattatcttcagtataaaaatgttcgacctgattatttg
aaagctatctggaatgtgatcaactgggagaatgtatcttcgagatatgcatcttgcaaa
aagtag

DBGET integrated database retrieval system