KEGG   Coturnix japonica (Japanese quail): 107315732Help
Entry
107315732         CDS       T04297                                 

Definition
(RefSeq) hexokinase-1
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
cjo  Coturnix japonica (Japanese quail)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Neomycin, kanamycin and gentamicin biosynthesis
Metabolic pathways
Carbon metabolism
Insulin signaling pathway
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cjo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    107315732
   00051 Fructose and mannose metabolism
    107315732
   00052 Galactose metabolism
    107315732
   00500 Starch and sucrose metabolism
    107315732
   00520 Amino sugar and nucleotide sugar metabolism
    107315732
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    107315732
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    107315732
Enzymes [BR:cjo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     107315732
Membrane trafficking [BR:cjo04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    107315732
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
6
AA seq 918 aa AA seqDB search
MAVRKEPSALDVSGYCCSPLCKIDKYLYAMRLSDETLIDIMARFRREMKNGLSRDFNPTA
TVKMLPTFVRSIPDGSEKGDFIALDLGGSYFRILRVKVSHEKKQTVQMETEIYNTPEDII
HGSGTRLFDHVAECLGDFMEKQQIKDKKLPVGFTFSFPCRQSKLDEGILITWTKRFKASG
VEGADVVKLLNKAIKKRGDYDADIMAVVNDTVGTMMTCGFDDQRCEVGLIIGTGTNACYM
EEMRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKMVSG
MYMGELVRLILVKMAKEGLLFEGRITPELLTKGKFETKHVSAIEKSKEGLNKAKEILTRL
GVEPSHEDCIAVQHVCTIVSFRSANLVASTLGAILNQLRDNKGVGRLRTTVGVDGSLYKM
HPQYARRLHKTTRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLSEQHRLIDETLAEFKL
THEQLLQVKKRMRTEMEAGLKKKSHETAKVKMLPTFVRSTPDGTENGDFLALDLGGTNFR
VLLVKIRSGKRRTVEMHNKIYAIPIEVMQGTGEELFDHIVTCISDFLDYMGIKGARLPLG
FTFSFPCKQTSLDAGILLNWTKGFKATDCEGEDVVYLLREGIKRREEFDLDVVAVVNDTV
GTMMTCAYEDPNCEIGLIVGTGSNACYMEEMKNVELVEGDQGRMCINMEWGAFGDNGCLD
DIRTIYDKAVDDYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKRGFLFRGQISETLKTR
HIFETKFLSQIESDRLALLQVRTILQQLGLNSTCDDSIIVKTVCGAVSKRAAQLCGAGMA
AVVDKIRENRGLEHLEITVGVDGTLYKLHPHFSRIMHQTVKDLAPKCDVTFLLSEDGSGK
GAALITAVGCRLRDAEQN
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atggccgtgcggaaggagcccagtgccctggatgtgtctggctactgctgctccccgctg
tgcaaaattgataaatacctttacgccatgcggctctccgatgaaactctgatagacatc
atggctcgcttccggagagaaatgaagaacggcctctccagagatttcaacccaacagct
acagtgaaaatgctccctacctttgtgaggtccattcctgatggctcagagaaaggagat
ttcatcgctctggatctcggtggttcttactttcgaattctgcgagtgaaagtatcgcat
gaaaaaaagcagacagtacaaatggaaactgaaatttataatacacctgaagatatcatt
catggtagtgggacacggctttttgatcatgttgctgaatgcctgggagactttatggag
aaacaacaaatcaaagacaagaaattacctgttgggtttaccttttctttcccgtgccga
caatctaagctggatgagggcattctgataacctggacaaagcgcttcaaagcgagtgga
gtggagggagcagatgttgtgaagctgcttaacaaggccatcaagaaacgtggggactat
gatgcagatatcatggctgttgtgaacgataccgttgggactatgatgacctgtggtttt
gatgaccaacgttgtgaagttggtttgatcattggcactggcaccaatgcctgctacatg
gaggagatgaggcacatcgacctggtggagggggacgagggcaggatgtgcataaacaca
gagtggggggcctttggagatgatggctcactagaagacatcaggactgagtttgataga
gagattgaccgtggatccctaaatcctggcaagcaactgtttgagaagatggtcagcggg
atgtacatgggggagctggtgaggctcatcctggtgaagatggccaaggagggactgctc
tttgaggggagaatcacccctgagcttctcaccaaaggaaagtttgagacaaagcatgtt
tctgccattgaaaagagcaaagaaggtttgaacaaagccaaagaaatcttaacccgcctg
ggggtggagccatcccacgaggactgtattgcagtccagcacgtctgcaccattgtgtcc
ttccgctcagccaacctggtggcctccacgctgggtgccatcctcaaccagctgcgggat
aacaaaggggttggccgcctccgcaccactgtgggggttgatggctccctctacaagatg
catccacagtacgctcggcgcctgcataaaaccacccggcgcctggtgcctgactcagat
gtgcggttcctgctgtcggagagcggcagtgggaaaggggcagcgatggtgacagcggtg
gcgtaccggctgtcggagcagcaccggctcatcgacgagacgctggctgagttcaagctc
acccatgagcagctgctgcaggtgaagaagaggatgaggacagagatggaagcaggcctg
aagaagaagagtcatgagactgccaaagtgaaaatgctgcccacctttgtccgcagcaca
ccagatggcacagagaatggagactttctggcgcttgaccttggagggacaaacttcaga
gtgttgctggtaaaaattcgcagtggtaaaaggagaactgttgaaatgcacaacaagatc
tatgcaattcctatagaggtgatgcagggaacgggagaagagctgtttgaccacatcgtt
acctgcatttcggacttcctggactatatgggaataaaaggtgcacgacttcctcttggc
ttcacattctccttcccttgcaagcagaccagtctggacgctggtatccttctcaactgg
acaaaaggattcaaagctacagactgtgagggagaagacgtggtgtatttgctaagagaa
ggaattaaaagaagagaggagtttgacttggatgtggtagctgtagtgaatgatacggtg
ggcacgatgatgacttgtgcttatgaagacccaaactgtgaaattggactcattgtggga
actggcagcaatgcctgctacatggaggagatgaaaaacgtggagctggtggagggcgac
cagggccgcatgtgtatcaacatggagtggggcgcgttcggggacaacggctgcctggac
gacatcaggacaatatatgacaaagcagttgatgactattcactaaatgctggaaagcaa
aggtacgagaagatgatcagtgggatgtacctgggggaaatagtccgcaatattttgatt
gacttcaccaaacgagggttcctgttcagagggcagatctcagaaacgctgaagaccagg
catatctttgaaaccaagttcctttcacagattgagagtgacaggttagccttgcttcag
gtgcgaaccattctccagcagctgggactcaacagcacatgtgacgacagtatcattgtc
aagacagtgtgcggagcggtgtcaaagcgagcagctcagttgtgtggtgctggaatggct
gcagttgtagataaaattagggagaacagaggcttggagcacctggagataacggttggt
gtggatgggactctgtacaaactacacccacacttttcgaggattatgcaccaaacagtc
aaagatctggcacccaagtgtgatgtgaccttcctgctctcggaggacggcagcgggaaa
ggggcagcgctcatcacggcagtgggatgcaggcttcgcgatgctgagcagaactga

DBGET integrated database retrieval system