KEGG   Coturnix japonica (Japanese quail): 107318235Help
Entry
107318235         CDS       T04297                                 

Definition
(RefSeq) intestinal-type alkaline phosphatase-like
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
cjo  Coturnix japonica (Japanese quail)
Pathway
cjo00730  Thiamine metabolism
cjo00790  Folate biosynthesis
cjo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cjo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    107318235
   00790 Folate biosynthesis
    107318235
Enzymes [BR:cjo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     107318235
Exosome [BR:cjo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107318235
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cjo00537]
 Enzymes
  107318235
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 107318235
NCBI-ProteinID: XP_015727324
LinkDB All DBs
Position
9
AA seq 520 aa AA seqDB search
MRLLAPLALCLGLWAELSAAVIPVEEEDPTFWNRKAAAALDATLKIEPRTAEAKNLIIFL
GDGFGVPSITATRILKGQLKGNLGPETPLALDSFPYVALSKTYTVDRMVPDSAGTATAYL
CGVKGNYKTIGLSAAARYGQCNTTKGNEVISVLQRARKAGKAVGIVTTSRVQHASPSGTY
AHVVDRNWYADASMPAEALAQGCKDIAWQLVHNVDINVIMGGGRIYMTPAGTPDPEYPTY
SSENGIRNDGQNLINKWLSERKGARYVWNRTEMLEAAADPSVTYLMGLFEPMDMKYEMVH
NATLDPSLTEMTEAAIKVLSRNPNGFYLFVEGGRIDHGHHEGMAQRALTEAVEFDTAIER
AGELLDEADTLTVVTADHSHVFSFGGYILRGTSIFGLAPLQATDQKNYTSILYGNGPGYP
GAIRPDVNSSIAGDFSYMQQAAVPLKSESHGGEDVAILAKGPMAYLFHGVQEQNYIAHAM
AYAACLEPYENCRQRTSAASSAHLTPLALLLPALLLSLFH
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgctggcacccctcgccctctgccttggcctctgggcagagctcagtgctgct
gtcatcccagtggaggaggaggatccaaccttctggaacaggaaggcagccgctgccctt
gatgccaccctcaagatcgagcccaggacggcagaagccaaaaacctcatcatcttcctt
ggggatggattcggggtccccagcatcacagccacccggatcctaaaggggcagttgaag
gggaacctgggacctgagactccccttgctctggattctttcccctacgtggctctctca
aagacatacactgtggaccgtatggtccccgacagcgcgggcacagccactgcctacctg
tgtggggtgaagggcaactacaagacaatagggctgagtgcagccgcacgctacggccag
tgcaacaccacgaagggcaacgaggtcatctcagtgctgcagcgagcccgtaaagctggg
aaggcagtgggcatcgtgacgacctcgcgggtgcagcacgcatcgccctcggggacctac
gcgcacgtggtggatcgcaactggtacgcggacgccagcatgccagctgaggccttagca
cagggctgcaaggacattgcctggcagctggtgcacaacgtggacatcaatgtgatcatg
ggaggcggtcggatatacatgacacctgcggggacaccagaccctgagtatcccacatac
agctccgagaatgggatacggaatgatgggcagaacctcattaacaagtggctgtcagaa
cggaagggtgcccgctatgtctggaacaggacagagatgctggaagctgctgcagacccc
agtgtgacttatctgatgggactcttcgagcccatggacatgaagtatgaaatggtgcac
aatgccaccctggatccctctctcactgagatgacggaagcagcgatcaaagtcctgagc
aggaaccccaatggtttctacctctttgtggaaggtgggaggatcgaccacggccaccat
gagggcatggctcagcgggcactgacggaggcggtggagtttgacacggccattgagcgt
gcaggcgaactgctggacgaggcggacacactgaccgtggtcactgctgaccattcacac
gtcttttcctttggcggttacatcctgcgtggcacctccatcttcggcctggcccctcta
caagccaccgaccagaagaactacacctccatcctctatgggaatgggccgggctaccca
ggcgccatccggcctgatgtgaacagcagcattgctggggatttcagttacatgcagcag
gcggccgtccccctcaagtcagagtcccacgggggtgaggatgtggccatcctggccaaa
ggccccatggcctacctcttccatggggtgcaggagcagaactacattgcccacgccatg
gcctacgctgcctgccttgagccctatgaaaactgccgacagcgcaccagtgctgcatct
tcagcccacctcaccccgctggctctgctcctgcctgctttgctcttatccctcttccac
tga

DBGET integrated database retrieval system