KEGG   Coturnix japonica (Japanese quail): 107325367Help
Entry
107325367         CDS       T04297                                 

Gene name
TMPRSS9
Definition
(RefSeq) transmembrane protease, serine 9
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
cjo  Coturnix japonica (Japanese quail)
Brite
Enzymes [BR:cjo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     107325367 (TMPRSS9)
Peptidases [BR:cjo01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   107325367 (TMPRSS9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Ldl_recept_a Trypsin_2 SEA
Motif
Other DBs
NCBI-GeneID: 107325367
NCBI-ProteinID: XP_015741609
LinkDB All DBs
Position
28
AA seq 1114 aa AA seqDB search
MDQIKPVLGRRGPRASCWKVTITATVVGCVTALYLGILLACHPAAETSFEHTVELRGITF
NSSLQAENSDYYRALTPALERLFLSSFQDSQLDWSCTGCTILGYRSGNSSVIVRFRLHFA
PQDSQPLSSATEEAALRHGLAAALQEQGLSLAAFGTISSASLTAPSDVSPYRPGLKSGSC
PGDLFMCHNTQCVWKENPECDGQKDCADASDEKGCDCGSRPAMQTASRIVGGTEASRGEF
PWQVSLRENNEHFCGAAILTEKWLVSAAHCFTEFQDPAMWAAYAGTTSISGADSGAVKMG
ISRIIPHPSYNTDTADYDVAVLELKKPVTFTKHIQPVCLPHAGHHFPTNKKCLISGWGYL
KEDFLVKPEFLQKATVKLLDQALCSSLYSHALTDRMLCAGYLEGKIDSCQGDSGGPLVCE
EPSGKFFLAGIVSWGIGCAEAKRPGVYTRVTKLRDWILDAISPFPTSITRTVPLMQSSTN
SNTVTAEELNATTSTATPSSSLAPAASKPATAPRPQECGGRPGLSKPNKIVGGTDASRGE
IPWQVSLQEDSMHFCGATIIGDRWLLSAAHCFNETNPEEIEAYMGTTSLNGTDGSAVKVN
VTRVIPHPLFNPMLLDFDVAVLELARPLVFNKYIQPICLPLAVHKFPVGKKCIISGWGNL
QEGNVTMSESLQKASVGIIDQKTCNFLYNFSLTERMICAGFLEGKIDSCQGDSGGPLACE
LTPGVFYLAGIVSWGIGCAQAKKPGVYSRITKLNDWILDTISQFPSASTGAPSTSSTTRS
TADIPTLHPSTTATSPISETTLSEITTTMEETSTAPKSTEPAKPTQAPVVPCTSLTFRCS
SNVCIGKENPECDGIVDCSNGFDESNCDCGLTTALAFSKIVGGSSAARGEWPWQVSLWLR
QKEHKCGAVLIADRWLLSAAHCFDIYSDPKMWVAFLGTPFLNGNDGKMEKIFRIYKHPFY
NVYSLDYDVALLELSSPVRFSSTIKPICLPDNSHVFQEGARCFITGWGSTKEGGLMTKHL
QKAAVNVIGDQDCKKFYPVQISSRMVCAGFPHGTVDSCSGDAGGPLACKEPSGRWFLAGI
TSWGYGCARPFFPGVYTKVTAVQGWIAQNLKLWS
NT seq 3345 nt NT seq  +upstreamnt  +downstreamnt
atggaccaaataaagccagtgctgggcagaaggggaccgagggccagctgctggaaggtg
accatcactgccactgtcgtgggctgtgtgacagccctatacctggggatcctgctggcc
tgtcatcctgcagcagagaccagctttgagcacacagtggagctgcgagggatcacattc
aacagcagtttgcaagcagagaactcggactattaccgggcgctgacgcccgccctcgaa
aggctgtttctgtccagtttccaggactcccagctggactggagctgcactggttgcacc
atcctgggctacaggagtgggaactcgagtgtcattgtccgtttccgcctccacttcgcc
ccacaggactcccagcccctcagctctgccacggaggaggcagctctccgacacgggctg
gcagctgcgctgcaggagcagggcctctccctggccgccttcgggaccatctcctcagct
tctcttacagctcccagtgatgtttctccatacagaccaggactgaagtcagggagctgc
cctggtgacttgttcatgtgccacaacacacagtgtgtgtggaaagaaaaccctgaatgt
gacggccagaaggactgcgctgatgcctctgatgaaaagggctgtgactgtgggagccgc
cctgccatgcagactgccagcaggatagtgggaggcacagaggcttccagaggggagttc
ccctggcaggtcagcctgcgagagaacaacgagcacttctgtggtgctgcaatcctcacg
gagaagtggctggtgtctgctgctcactgctttactgagttccaggacccggccatgtgg
gcagcttacgcagggaccacctccatcagcggtgcagacagcggtgcagtgaaaatgggc
atctcccggatcatccctcacccctcctacaacactgacacggctgactacgacgtggct
gtgctggagctgaagaaacccgtgaccttcactaagcacatccagcccgtgtgcctgcca
cacgctgggcatcacttccctaccaacaagaagtgcctgatctctggctggggatacctc
aaggaggatttcttggtgaaacccgagttcctacagaaggcgacagtgaagctgctggac
caggcgctgtgctccagcctctacagccatgccctcacagacaggatgctgtgtgccggt
tacctggaggggaaaattgactcctgccagggggactctggtgggccgctggtttgtgaa
gaaccgtctggcaagtttttcctggcggggatcgtgagctggggaattggatgtgcagaa
gccaaacggccgggggtctacacacgtgtcaccaaactgagagactggatcttggacgct
atttctccctttcccacctccataacacgcactgtcccactaatgcaatccagtactaac
agtaacacggtcactgctgaagaactgaacgccaccaccagcacagcaacccccagctct
tcactggccccagctgccagcaaaccagcaactgcacccagaccacaggagtgtggagga
cgacctggcctctccaaacccaacaagattgtgggaggaaccgatgcttccagaggggag
atcccctggcaggtcagcctgcaggaagactcgatgcatttctgtggggcaacgatcatt
ggggaccgctggctgctgtcagctgcacactgcttcaacgagacaaatccagaagagatt
gaagcctacatggggacgacatcactaaatggaacagacgggagcgcagtgaaagtcaat
gtaacacgagtgatcccacatcctctcttcaaccccatgcttctggactttgatgtagct
gtacttgagctggcaagacccctcgtcttcaacaaatacatccagcccatctgcctccca
ctcgctgtgcacaagtttcctgttggcaagaaatgcatcatttctggatgggggaacctc
caagaagggaatgtcaccatgtctgagagtctgcagaaagcctctgtgggcatcatagac
cagaaaacctgcaacttcctctacaacttctccctcactgagcggatgatctgcgctggt
ttcctggaggggaagatagactcgtgccagggagactcaggagggcccttggcctgtgag
ctcaccccaggtgtgttttatctggctggcatcgtgagctggggaattggatgcgcccag
gctaagaaacccggcgtgtactccagaattaccaaactcaacgactggatcctggacacc
atctcacagtttcccagtgccagcacaggagctccttccacttcatccaccaccagaagt
actgcagacatccccacgctccatcccagcacaacagctacaagccccatcagtgaaacc
accctgagtgagattaccaccaccatggaagaaacctccacagctccgaaatccactgag
cctgccaagcccacccaggccccagtggtgccttgtaccagcctcaccttcaggtgttcc
agcaacgtctgcattggaaaagaaaatcccgaatgtgacggaattgttgactgcagcaat
ggatttgatgagagcaattgtgactgcggcctgaccactgctctggccttcagcaagatc
gtgggtgggagctcagcagctcgaggagaatggccctggcaagtcagtctctggcttcgg
cagaaggagcacaagtgtggggctgtcctcattgccgacaggtggctgctctctgcagct
cactgctttgatatttacagtgaccccaaaatgtgggtggcctttctaggaacacctttc
ctgaatggcaacgacggcaaaatggagaaaatattccgtatctacaagcatcctttttac
aacgtctacagcctggactacgacgtggcgctgctggagctgagcagccccgtcaggttc
agcagcaccatcaaacccatttgtctgccagacaactcacacgtcttccaggaaggagcc
aggtgcttcatcacaggctggggctccaccaaggaaggaggcctcatgacaaagcatctg
caaaaagcagcagtgaatgtgattggagaccaggactgcaaaaagttctaccctgtccag
atcagcagcaggatggtgtgtgctgggttcccacacggcaccgtcgacagttgctcaggt
gatgcaggtgggcccctggcatgtaaagaaccctcaggacggtggtttctagcaggaatc
acgagctggggctatggctgcgcccggccgttcttccctggggtctacaccaaagtcacc
gcggtgcagggctggatcgcgcagaacctcaagctctggagctga

DBGET integrated database retrieval system