KEGG   Caldicellulosiruptor kristjanssonii: Calkr_0797Help
Entry
Calkr_0797        CDS       T01356                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
cki  Caldicellulosiruptor kristjanssonii
Pathway
cki00473  D-Alanine metabolism
cki01100  Metabolic pathways
cki01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cki00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    Calkr_0797
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    Calkr_0797
Enzymes [BR:cki01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Calkr_0797
Peptidoglycan biosynthesis and degradation proteins [BR:cki01011]
 Precursor biosynthesis
  Racemase
   Calkr_0797
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: ADQ40320
UniProt: E4S421
LinkDB All DBs
Position
864230..865402
Genome map
AA seq 390 aa AA seqDB search
MNKLSLYNRVWAEIDLDNLVYNLENIKKKILPQTRIMAVVKADAYGHGAVEISRVLVKNG
VSMLAVAIIDEALQLRHFNFDVPILILGFTPFELSEQVVENEISQTVYTYEQAYYLSQAA
QKIGKKAKIHIKVDTGMGRIGFLCCNESIQTVLNIAKLPNIELEGIFSHFSSADDPDSDH
FTHEQFMKFENFVKELNKNGVYFKYKHIANSSAAIRFPQYQLDVVRLGLILYGLYPSSSL
KEHLSIKPVMSVKARVINVKEVPEGFPISYNRRYITTRKSKIATIPIGYADGFTRVGSSQ
RHVLIKGEFAKVVGSICMDQCMVDVTDIEDVKIGDEVVIIGRQGKNEILADHLAEQIGTI
NYEVVCSFSKRIPRVYIKDGRVVKILNYIL
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaattgtcgctctacaacagggtgtgggcagagattgaccttgacaatttggta
tacaatcttgaaaatatcaagaaaaagattttgccacaaacaagaataatggcagttgtg
aaggctgatgcatatggacacggagcggttgaaatttcaagagtgcttgtcaaaaatggc
gttagcatgcttgctgtggcaataattgacgaggcattgcagctgagacatttcaatttt
gatgttcccattttaattttgggttttaccccttttgagctttctgagcaggttgttgaa
aacgagataagccagactgtttacacgtatgaacaggcatattatcttagccaggctgca
caaaagatagggaaaaaagccaagatacatatcaaagttgatactggaatggggagaatt
ggatttttatgttgcaatgagagtatacagacagtactaaatattgcaaagcttccgaac
atcgaacttgaaggaatattctctcatttttcatctgcagacgacccggactcagaccat
tttacgcatgagcaatttatgaaatttgaaaactttgtgaaagaactcaataaaaatggg
gtatactttaaatataagcacattgcaaatagcagtgcggcaatccgtttcccccagtat
caacttgatgttgtaaggcttggtcttattctatacgggctttatccaagcagcagtttg
aaagaacacctaagtattaagcctgtaatgtctgtcaaggcaagggttatcaatgtaaag
gaggtgccggaaggctttccgataagctacaacagaaggtatataaccacacgcaaaagc
aaaattgccaccatacctatcggttatgcagatggttttacgcgtgttggaagtagtcaa
aggcatgttctcataaaaggtgaatttgccaaggttgttgggagtatatgcatggaccag
tgcatggtagatgtgaccgatattgaggatgtgaagattggtgatgaagttgtcattata
ggaagacaagggaaaaatgagattttggctgaccatttggctgagcagattggaactatc
aactatgaggttgtatgttcttttagcaagcgaattccacgggtttatatcaaggatggg
cgagttgtcaaaatattaaattatatcttatga

DBGET integrated database retrieval system