Clostridium kluyveri DSM 555: CKL_1617 Help Entry CKL_1617          CDS       T00564                                  Symbol ilvH Name (GenBank) IlvH   KO K01653   acetolactate synthase I/III small subunit [EC:2.2.1.6] Organism ckl  Clostridium kluyveri DSM 555 Pathway ckl00290   Valine, leucine and isoleucine biosynthesis ckl00650   Butanoate metabolism ckl00660   C5-Branched dibasic acid metabolism ckl00770   Pantothenate and CoA biosynthesis ckl01100   Metabolic pathways ckl01110   Biosynthesis of secondary metabolites ckl01210   2-Oxocarboxylic acid metabolism ckl01230   Biosynthesis of amino acids Module ckl_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine ckl_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:ckl00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     CKL_1617 (ilvH)    00660 C5-Branched dibasic acid metabolism     CKL_1617 (ilvH)   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     CKL_1617 (ilvH)   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     CKL_1617 (ilvH) Enzymes [BR:ckl01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      CKL_1617 (ilvH) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ALS_ss_C ACT_5 ACT ACT_8 DUF211 ACT_4 Motif Other DBs NCBI-ProteinID:  EDK33659 UniProt:  A5N8M8 LinkDB All DBs Position complement(1693173..1693670) Genome browser AA seq 165 aa AA seqDB search MSTIKKHVLSVLVENHSGVLSKVAGLFSRRGYNIHSLTVGITEDPEISRITIVSIGDDYE VEQISKQLNKLIEVIKIIDLTDDPSVYRELSLVKVSAEPSNKLIIMETVNTFRGNIVDMD EKSMMIEITGDEDKISAFIEIMKPYGIKEIVRTGLTALQRGGCKA NT seq 498 nt NT seq  +upstreamnt  +downstreamnt gtgagtaccataaaaaaacatgtattatcagtattagtagaaaatcattcaggtgtttta agtaaagtagctggcctgttcagtagaaggggatataatatccacagtcttacagtagga atcacagaggatcctgaaatatcaaggataactattgtatctattggggatgactatgag gtggaacagattagtaaacagctgaataagttaattgaagttataaaaataatagattta acagatgatccttcagtgtatagggaactttcactggtaaaggtgtctgcagagccaagt aataaattgataattatggagactgtaaatacttttaggggaaatatagttgatatggat gaaaagagtatgatgattgaaataactggagatgaagataaaatatccgcttttattgaa atcatgaaaccttatgggatcaaagaaattgtacgtacaggacttacagctctccaaaga ggaggatgtaaagcataa

DBGET integrated database retrieval system