KEGG   Citrobacter koseri: CKO_01668Help
Entry
CKO_01668         CDS       T00592                                 

Definition
(GenBank) hypothetical protein
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cko  Citrobacter koseri
Brite
Enzymes [BR:cko01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CKO_01668
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
1602956..1603537
Genome map
AA seq 193 aa AA seqDB search
MSFELPALPYAKDALAPHISAETLEYHYGKHHQTYVTNLNNLIKGTPFEGKSLEEIVRSA
EGGVFNNAAQVWNHTFYWNCLAPDAGGEPTGKLADAIVASFGSVADFKAQFTDAAIKNFG
SGWTWLVKGTDGKLAIVSTSNAGTPLTTDATPLMTVDVWEHAYYIDYRNARPGYLEHFWA
LVNWDFVAKNFAA
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtttgaattacctgcattaccgtatgccaaagatgctcttgcaccgcacatttct
gctgagacgctggaatatcattacggcaaacatcatcagacctatgtgaccaaccttaac
aacctgatcaaaggcacgccgtttgaggggaaatcactggaagagatcgttcgcagcgct
gaaggcggcgtcttcaataacgcggcccaggtctggaaccacaccttctactggaactgc
ctggcgccagatgctggcggcgaaccaacgggtaaactggctgacgccattgtcgcgtcc
ttcggcagcgttgccgatttcaaagcgcagttcaccgacgccgcaattaagaacttcggt
tccggctggacctggctggtgaaagggacggatgggaaactggctatcgtctctacgtcg
aatgccggtacgccgctgaccaccgacgccacgccgttgatgaccgttgatgtgtgggaa
catgcctactatatcgactaccgcaatgcccgtcctggctacctggagcacttctgggcg
ctggtaaactgggactttgtggcgaaaaacttcgcggcataa

DBGET integrated database retrieval system