KEGG   Citrobacter koseri: CKO_05029Help
Entry
CKO_05029         CDS       T00592                                 

Definition
(GenBank) hypothetical protein
  KO
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
cko  Citrobacter koseri
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cko00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CKO_05029
Enzymes [BR:cko01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     CKO_05029
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
4618014..4620044
Genome map
AA seq 676 aa AA seqDB search
MKLTAFALALMPGIVFASSWTSQGFPPFTAEGTGKFVSHAALTKGTRPLSLHIDQQCWQP
ADAIKLNQMLSLKPCEGTPPQWRLFKDGDYSLEIDTRSGTPTLTLSIKSTADPVASTVRQ
CPTWNGSPLTLEVSHTFPEGAVVRDYYSQQTATVKNGQITLQPGATSNGLLLLERAETDT
PAAFNWHNATVYFVLTDRFQNGDPTNDQSYGRHKDGMEEIGTFHGGDLRGLANKLDYLQH
LGVNALWISAPFEQIHGWVGGGTKGDFPHYAYHGYYTQDWTTLDANMGSEGDLRALVDGA
HQRGIRILFDVVMNHTGYATLADMQTFRFGALYLQGDELKKTLGERWTDWKPAAGQSWHS
FNDYINFSDKAAWEAWWGKEWIRTDIGDYDNPGFDDLTMSLAFLPDIKTESTTPSGLPVF
YKNKPDTRAKAIEGYTPRDYLTHWLSQWVRDYGIDGFRVDTAKHVELPAWQQLKTQASAA
LTEWKQANPDKTLDDTPFWMTGEAWGHGVMQSDYYRHGFDAMINFDYQEQAAKAVDCLAN
MDATWQQMAEKLQDFNVLSYLSSHDTRLFREGGDKAAELLLLAPGAVQIFYGDESARPFG
PTGSDPLQGARSDMNWQDINGKSAATVAHWQRISQFRARHPAIGAGKQTTLSLKQGYGFV
REHDDDKVMVVWAGRP
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttaccgcttttgcactggcgcttatgcccggcatcgtattcgcctcatcatgg
acatctcagggattcccgccctttacggcggaagggacgggtaagtttgtcagccatgcc
gcgttgacgaaaggtacgcgccctttgtcgctgcatattgaccaacagtgctggcaacct
gctgatgccataaaactcaatcagatgctgtcgctcaaaccgtgtgaaggcacgccgcca
cagtggcgactgtttaaagacggcgactactcgctggagattgatacccgctccggtacg
ccaacgctaacgctgtcgataaaaagcaccgccgatcccgtcgccagcacggtgcgccag
tgcccgacgtggaacggctcgccgctgaccctggaggtgagtcacaccttcccggaaggc
gctgtcgtgcgcgattactacagccagcaaaccgctaccgttaagaacggtcagattacg
ctgcaacccggcgcgaccagcaacgggcttttgttgcttgaacgcgcggaaaccgacacg
cccgccgcattcaactggcataacgcgacggtctactttgtgctgacagaccgtttccag
aacggcgatccgacgaatgatcaaagctatggccgccacaaagatggcatggaggagatt
ggcacctttcatggcggcgatttacgcgggctggcaaacaagctggactatctgcaacac
ctgggggtgaatgccctgtggatcagcgcgccgttcgagcaaatccacggctgggtcggc
ggcggtacgaaaggggacttcccgcattatgcctaccacggctattacacccaggactgg
accacgctggacgccaatatgggcagcgagggcgaccttcgcgcgttagtcgatggcgca
caccagcgcggcatccgtattctgtttgatgtggtgatgaaccacacgggctacgccacg
ctggcggacatgcagacattccggtttggcgcgctgtatctgcaaggcgatgagctgaaa
aagacgctgggcgaacgctggactgactggaagcccgccgccgggcaaagctggcacagc
tttaatgactacatcaacttcagcgacaaagcggcatgggaagcatggtgggggaaagaa
tggattcgcacggatattggcgattatgacaatcctggctttgacgatttgaccatgtcg
ctggccttcctgcccgatattaaaacggaatccacaaccccttccggcctgccggtgttc
tataaaaacaaaccggatacccgtgcaaaagccattgagggctacacgccgcgggattat
ctgacccactggctcagtcagtgggtgcgtgattacggcatcgacgggttccgcgtagat
accgccaaacacgtcgaacttcctgcctggcagcagttgaaaacccaggccagcgcggcg
ttgaccgagtggaaacaggccaacccggacaagacgctggacgacacgcctttctggatg
actggtgaagcctggggccacggcgtcatgcagagtgattattaccgccacggctttgat
gcgatgatcaactttgactaccaggagcaggcggcaaaagcggtcgattgtctggcgaat
atggacgccacctggcagcaaatggcagagaaattacaggatttcaacgtgctgagttat
ctctcctcacacgacactcgcctctttcgggaaggcggcgataaggccgcagagcttctg
ctgctggcgcccggcgccgtacagatcttttatggcgacgaatccgcacgcccctttggc
ccgacgggttccgatccgctgcaaggcgcccgttctgacatgaactggcaggatatcaac
ggtaaatccgccgccaccgtcgcccactggcagcgaatcagccagttccgcgccagacac
cccgccatcggcgccggtaagcaaaccacgctctcactgaagcaggggtacggttttgtg
cgcgagcacgacgacgataaggtcatggtcgtctgggcgggtcgcccttaa

DBGET integrated database retrieval system