KEGG   Clostridium kluyveri NBRC 12016: CKR_3037Help
Entry
CKR_3037          CDS       T00832                                 

Definition
(GenBank) hypothetical protein
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ckr  Clostridium kluyveri NBRC 12016
Brite
Enzymes [BR:ckr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CKR_3037
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: BAH08088
UniProt: B9DWJ5
LinkDB All DBs
Position
complement(3412982..3413575)
Genome map
AA seq 197 aa AA seqDB search
MSHVLPELPYDYNALEPYYDEQTVKLHHDIHHKGYVDGLNTAETKLKEARESGDYSLVKH
WEKELAFHGSGHILHKIFWENMKPNGGGAPSGEVSEKINEFFGSFEAFKDQFTKAAIAVE
GSGWCALVWNNIFNKLEILQIEKHQNLTQWGSTPILVVDVWEHAYYLKYQNKRADFVNNW
WNLINWEDVNKKLSEVK
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgagtcacgttttaccagaactaccttatgattataatgcattggaaccatattacgat
gagcagactgtgaagttacatcatgatatacatcataaaggatatgtagatggtctgaat
acagctgagactaagcttaaagaagcaagagaaagtggagattactcacttgttaagcat
tgggaaaaagaattggcttttcacggcagtggtcacatactacataaaattttttgggaa
aatatgaagccaaatggtggaggcgctccttcaggtgaagtatctgaaaaaatcaatgaa
ttttttggaagttttgaagcatttaaagatcaatttacaaaggcagctattgcagtagaa
ggttcaggatggtgtgctcttgtatggaataatatatttaataaactagaaatattacaa
attgaaaaacatcaaaatttaactcaatggggcagtacacctatacttgtagttgatgta
tgggagcatgcatattatttgaagtatcaaaataagagagcagatttcgttaacaattgg
tggaatttaattaattgggaagatgtaaataagaaattatcagaagttaaataa

DBGET integrated database retrieval system