KEGG   Clostridium sporogenes: CLSPO_c23380Help
Entry
CLSPO_c23380      CDS       T03905                                 

Gene name
sodF
Definition
(GenBank) putative superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cld  Clostridium sporogenes
Brite
Enzymes [BR:cld01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CLSPO_c23380 (sodF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AKC63058
UniProt: A0A1V9IX24
LinkDB All DBs
Position
complement(2618763..2619359)
Genome map
AA seq 198 aa AA seqDB search
MAHTLPNLNYDYNALEPHYDEKTLKIHHDIHHKAYVDGLNKAEQKLEEVRESGDFTLIKH
WEKEIAFHGSGHILHTLFWENMTPNGKLNPEGSVIERIKQDFGDYEKFKKQFTEAAIAVE
GSGWTILAWNPMFQKLVILQAEKHQNLTQWGVVPLLILDLWEHAYYLKYQNRRSEFINAW
WNIVNWDIVNTRYDNVIK
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atggcacatactttaccaaatttaaattatgattataatgcattagaacctcattatgat
gagaagactttgaaaattcatcatgatattcatcataaagcttatgtagatggattaaat
aaagcagaacaaaagcttgaagaagttagagaatcaggagattttactttaataaaacat
tgggaaaaggaaatagcttttcatggatccgggcatattttacatacattattttgggaa
aatatgacccctaatggaaagctaaaccctgagggatctgtaattgaaagaataaaacaa
gattttggggactatgaaaaatttaaaaaacaatttactgaagctgctatagcagtggaa
ggttcaggttggactattttagcatggaatcctatgtttcaaaaattagtaatattgcag
gcagaaaaacatcaaaatttaactcaatggggagtggttccattgctaattttagattta
tgggaacatgcatattatttaaaatatcaaaatagaaggtcagagtttattaatgcttgg
tggaatattgtaaattgggatatagtaaatactagatatgataatgttataaaataa

DBGET integrated database retrieval system