KEGG   Clostridium sporogenes: CLSPO_c35540Help
Entry
CLSPO_c35540      CDS       T03905                                 

Gene name
alr3
Definition
(GenBank) alanine racemase 1
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
cld  Clostridium sporogenes
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cld00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    CLSPO_c35540 (alr3)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    CLSPO_c35540 (alr3)
Enzymes [BR:cld01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CLSPO_c35540 (alr3)
Peptidoglycan biosynthesis and degradation proteins [BR:cld01011]
 Precursor biosynthesis
  Racemase
   CLSPO_c35540 (alr3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(3884767..3885927)
Genome map
AA seq 386 aa AA seqDB search
MFRNLRAVWAEIDIDNLQHNLKQIKKICDNKEIIGVIKANAYGHGAMEIAPTLLENGVSR
LAVAVLSEAMELRMSGVKEPIMILGYTPWVLGDMLVDNDIEQSVYSYNDALELSRIAVEK
RKILKIHIVVDTGMGRIGFLPTKESVEEVYKISKLPNIKIEGVFSHFSSADELDKDYTLY
QMNKYNKFINKLEEKNIRIAIKHIANSAAIIDLESTHLDAVRAGIIMYGYYPSNYVLRNN
MKLKPVMSLKTRIVHIKKVSSGEYISYGRTFKTERESIIATLPIGYADGYNRLLSNKGKV
IVNGKLAPVIGRVCMDQCMIDVTSIENLKVGDVVTIMGEENGVSYTAEDIAAEIGTISYE
VICNVNKRVPRVYKKNNKIINVVNYI
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
ttgtttagaaatttaagagcagtatgggcagaaattgatatagataatttacaacataac
ttaaaacaaataaaaaaaatatgtgataataaagaaataataggggttataaaggctaat
gcatatggacatggagccatggaaatagcccctactcttttagaaaatggagtaagtaga
ttagcagtggcagttttaagtgaggctatggagcttagaatgagcggagtaaaagagccc
attatgatactaggctatacaccatgggttttaggggatatgcttgtagataacgatata
gaacaatctgtttactcatataatgatgctttagaactatctagaatagcagtggaaaaa
agaaaaatattaaaaatacatatagtagtagatacgggtatggggagaattggtttctta
cctacaaaagaaagtgtggaagaagtatataaaataagtaagttgcctaatattaaaata
gaaggagtattttctcatttttcttctgcagacgagttagataaagattatacactgtat
caaatgaataaatataataaatttataaataaattagaagagaaaaatattcgtatagct
ataaagcatattgctaatagtgcagccataatagatttagaaagtacccatttagatgca
gtaagagcaggtattataatgtatggatattatccatctaattatgtattaagaaacaat
atgaagttaaagcccgtaatgtctttaaaaactaggatagtacacataaaaaaggtatct
tcaggagaatatataagttatggtagaacttttaaaacagagagagaaagcataatagct
acattacctataggttatgcagatggatataatagattattaagcaataaaggaaaagtc
atagttaatggtaagcttgctccagtgataggaagagtttgtatggatcaatgtatgata
gatgtaacctctatagaaaatttaaaagttggagatgtggttacaattatgggagaagaa
aatggagtaagttatactgcagaagatatagcagcagaaataggcactataagctacgaa
gttatatgtaatgtaaataagagagtgcctagagtatacaagaaaaataacaaaattata
aatgtagtaaattatatataa

DBGET integrated database retrieval system