KEGG   Caldisphaera lagunensis: Calag_0832Help
Entry
Calag_0832        CDS       T02380                                 

Definition
(GenBank) aldehyde:ferredoxin oxidoreductase
  KO
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
clg  Caldisphaera lagunensis
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:clg00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Calag_0832
Enzymes [BR:clg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     Calag_0832
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
823325..825247
Genome map
AA seq 640 aa AA seqDB search
MDEWYGYTGRILRVDLTKKKIVVDELKKDWPKLYIGGLGFAARLMWDEQEPLTDPLSPDN
LLIATAGPMTGTLAPGSGNIFWAFKSPQTNFWGETRSGGKFGPFLKFSGFDMIVIKGKSD
EPVYLYLEGGKAELRKASHLWGMTVHQATDTLKREIGAKDVSIAAIGPAGENLVRYASIM
NDYDRAAGRSGGGTVMGSKKLKAIVAAGGYGVKVYDPERFLSLSYEAENAIINDPSNRAM
GAHGTIGGLKGLNAMGGLPTQNFRTGYFEKANKISADYLENNYMIKRRACYSCTIGCSRY
SYVAAGNYSTPPSEGPEYETADMAGAMPMIGNMEAIIRYNYLANNYGMDTITLGHTISWA
IEAYEMGMITDKETGGIKLKWGDADTFLELVDMIAYRKGFGNLLAEGSYWAAKKIGKGSE
NLVNHVKGLEFPAHDPRVESKFLAIQYAVGPRGACHEHPIYPSYDMMGVDSGLREVGLPW
PLPDRLEEVGVNRGKAYRVIALYGEVINSLGYCNFYAATTETGSLSPKRLATLYSSLTGI
ELTPMQIFEAGERSWNLKRAFNIREGLEKSHDMLPKRVITPIESGPAKGLKVEKPKELLE
ESYEGFGWDKETGYIKKSTLERLGLNDVAEYLEKIKKLSN
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atggatgaatggtatggttatactggaaggattttgagggttgatttaactaagaaaaaa
atcgttgtcgatgaactcaaaaaagattggcctaaattatatataggaggacttggtttc
gctgctagattaatgtgggatgagcaagaaccattaacagatccattatctccagataat
ttattaatagcaacagcaggcccaatgacaggcaccttagctccaggaagcggtaatata
ttctgggcttttaaatctccacaaactaatttctggggagaaacaaggtcaggaggtaaa
tttggaccatttttaaaattcagcggtttcgatatgatagttattaaaggaaaatcagat
gagcctgtatacttatatttagaaggaggtaaggcagagttaagaaaagcttctcatcta
tggggcatgacagttcatcaagcaacagatacattaaagagagaaattggagctaaagat
gtttccatagctgcaattggtccagctggagaaaatttagttagatatgcatcaataatg
aatgattatgatagagcagcaggcagaagtggtggaggtactgtaatgggatcaaagaaa
ttaaaggcaattgttgctgctggaggatatggtgttaaagtatatgacccagaaaggttc
ctctcattaagttatgaagctgaaaatgctataataaatgatccaagtaatagagccatg
ggtgcacatgggactataggaggattaaaaggattaaacgctatgggggggttgccaaca
caaaacttcagaactggttattttgagaaggcaaataaaatatcggctgattatttggaa
aataactatatgataaagagaagggcatgttatagttgtacaataggttgcagcaggtat
tcttatgttgcagcaggaaattattctactccaccaagcgaaggaccagaatatgaaact
gctgatatggcaggcgcaatgcccatgattggaaacatggaagctataattagatataat
tacctggctaataattatggtatggacaccattacgttgggtcatacaatctcatgggct
atagaggcatatgaaatgggaatgattacagataaagaaacaggtggaataaagttaaaa
tggggagatgctgatacatttttagaattagtagacatgatagcttacagaaagggcttc
ggtaatttattagctgaaggaagctattgggctgctaaaaaaataggtaaaggatccgag
aatcttgtaaatcatgtaaaaggcttggaatttcctgctcatgatccaagagttgaatct
aagtttttagcaatacaatatgctgtaggtcctagaggagcctgccatgaacatcccata
tatccatcttatgatatgatgggtgttgatagtggtttaagagaggttggtcttccttgg
ccgttaccagataggcttgaagaagtgggagttaacagaggaaaagcgtatagggttata
gctttatatggtgaagtaattaattccttaggttattgcaacttctatgcagctactact
gaaactggttcattgtcgccaaaaaggctggctaccctatattcatcactaacaggtatt
gaattgacaccaatgcaaatatttgaagcgggtgaaagatcatggaatttgaagagggca
tttaatattagagaaggattggaaaaatctcatgatatgctcccaaagagggttataact
cctatagagtctggtcctgcaaaaggattaaaagtagaaaaaccaaaagagcttttagaa
gaatcatatgaaggatttggttgggataaagaaacaggttatataaagaaatcaacccta
gaaagacttggcttaaacgatgttgcagaatatttagaaaaaattaaaaagttatcaaat
taa

DBGET integrated database retrieval system