KEGG   Columba livia (rock pigeon): 102086880Help
Entry
102086880         CDS       T02912                                 

Gene name
GAD2
Definition
(RefSeq) glutamate decarboxylase 2
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv00250  Alanine, aspartate and glutamate metabolism
clv00410  beta-Alanine metabolism
clv00430  Taurine and hypotaurine metabolism
clv00650  Butanoate metabolism
clv01100  Metabolic pathways
Module
clv_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:clv00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    102086880 (GAD2)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102086880 (GAD2)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102086880 (GAD2)
   00430 Taurine and hypotaurine metabolism
    102086880 (GAD2)
Enzymes [BR:clv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     102086880 (GAD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 102086880
NCBI-ProteinID: XP_013226379
LinkDB All DBs
Position
Unknown
AA seq 478 aa AA seqDB search
MSFLQDVVDILLQYVVKSFDRSTKVIDFHYPNELLQEYNWELADQPQTLEEILLNCRTTL
KYAIKTGHPRYFNQLSTGLDMVGLAADWLTSAANTNMFTYEIAPVFVLLEYVTLRKMREM
IGWPGGCGDGIFSPGGAISNMYAMLIARFKMFPEVKEKGMAAIPRLVAFTSEHSHFSVKK
GAAALGIGTDSVILIRCDERGKMIPSDLERRILEAKQKGFVPFLVSATAGTTVYGAFDPL
IAIADICKKYKIWMHVDGAWGGGLLMSRKHKWKLNGVERANSVTWNPHKMMGVPLQCSAL
LVREEGLMQSCNQMHASYLFQQDKHYDLSYDTGDKALQCGRHVDVFKLWLMWRAKGTTGF
EAQIDKCLELAEYLYNKIKNREGYEMVFDGKPQHTNVCFWYIPPSLRSMEDNEERMSRLM
KVAPVIKARMMEYGTTMVSYQPLGDKVNFFRMVISNPAATHQDIDFLIDEIERLGQDL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgtctttcctacaagacgttgtggacattttacttcagtatgtggtgaaaagttttgat
agatcaacaaaagtcattgatttccattacccaaatgagctgctccaggaatataactgg
gaactggcagaccagccacagaccttggaagaaattttattgaactgcagaacaactctg
aagtatgcaattaaaacagggcaccctagatattttaatcaactttcaactggattggac
atggttggattggcagcagactggctgacatcagcagcaaatactaatatgttcacctat
gaaattgctccagtgtttgtacttttggaatatgtcacactaaggaaaatgagagagatg
attggctggccagggggctgtggcgatgggatattttcacctggtggtgccatatctaac
atgtatgctatgttgattgcacgtttcaagatgttcccagaagttaaagaaaaaggaatg
gcagctattcccagactggttgccttcacatcagaacatagtcacttttccgtgaagaaa
ggagctgcagccttgggtattggtacagatagtgtgattctgattagatgtgatgaaaga
gggaaaatgatcccatcagaccttgaaagaagaattcttgaagccaaacaaaaaggattc
gttccttttctggtgagtgcgacggctgggacaacagtgtatggggcatttgatcccctc
atagctattgcagacatttgtaagaagtacaaaatctggatgcatgtggatggagcatgg
ggtggtgggctcctgatgtcaagaaaacacaaatggaagttaaatggcgttgaaagggcc
aattcagtgacctggaaccctcacaagatgatgggcgtcccactgcagtgttcagccctg
cttgtaagagaagagggattgatgcagagttgcaatcaaatgcatgcttcctacctcttt
caacaagacaagcactatgacctgtcttatgacacaggagacaaggctttgcaatgtgga
cgacatgttgatgtcttcaagctatggctgatgtggagggcaaagggaaccacagggttt
gaagcacaaattgataagtgcttggagcttgcagaatacctatacaataaaataaagaac
agagaaggctatgaaatggtgtttgatggaaagcctcagcacacaaatgtctgcttctgg
tatatacctcccagcttgcgcagtatggaagacaatgaagaaagaatgagccgccttatg
aaggtggcaccagtgataaaagccaggatgatggagtatggcacgaccatggtgagctat
cagcctctgggagacaaagtgaacttcttccgcatggtcatctcaaaccctgcagcaact
caccaagacattgatttcctgattgatgaaatagaacgcctgggacaagatttataa

DBGET integrated database retrieval system