KEGG   Columba livia (rock pigeon): 102087604Help
Entry
102087604         CDS       T02912                                 

Definition
(RefSeq) intestinal-type alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv00730  Thiamine metabolism
clv00790  Folate biosynthesis
clv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:clv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    102087604
   00790 Folate biosynthesis
    102087604
Enzymes [BR:clv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     102087604
Exosome [BR:clv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102087604
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:clv00537]
 Enzymes
  102087604
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 102087604
NCBI-ProteinID: XP_005513301
UniProt: A0A2I0LH58
LinkDB All DBs
Position
Unknown
AA seq 526 aa AA seqDB search
MELLAPLTLCLGLWAGSSAAVIPVEEENPSFWNNQAAAAIQASFNIQPRIREAKNLIIFL
GDGFGIPTMTATRILKGQQKGNLGPETPLAMDTFPYVALSKTYNVDRQVPDSAGTATAYL
CGVKTNYRTIGVSAAARYHQCNTTFGNEVISVLERARKAGKAVGIVTTTRVQHASPSGTY
AHVVDRDWYADASMPAEARSQGCKDIAWQLIHNVDINVIMGGGRIYMTPAGTPDPEYPNS
TLMNGVRRDGNNLINMWLEARQGARYVWNRTEMLAAAADPNVNYLMGLFEPMDMTYDMAR
DTNLDPSLAEMTEAAITILKRNPNGFYLFVEGGRIDHGHHEGAAQKALTDAVAFDRAIER
AGIVTDEAETLTVVTADHSHVFSFGGYTLRGSSIFSLAPSEAADGKSYTSILYGNGPGYV
EGNRTDVDESTVMNFNYRQQAAVPLISETHGGEDVAILAKGPMAYLFHGVQEQTYIAHVM
AYAACLEPYTDCRQRTSNTFSAASARAVPLLLPTLLLPTLLLPLFH
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggagctcctggcacccctcaccctctgcctgggcctctgggcagggtccagcgctgct
gtcatcccagtggaggaggagaacccgtccttctggaacaatcaggcagccgcagccatc
caggcctccttcaacatccagcccaggataagagaagccaaaaacctcatcatcttcctg
ggggatggattcgggatccccactatgacagccacccgcatcctaaagggacagcagaag
ggaaatctgggccctgagacgcccctcgccatggatactttcccctacgtggctctctct
aagacatacaatgtggatcgtcaggtccccgacagtgcagggacagccacagcctatctc
tgtggggtgaagaccaactacaggactattggggtgagcgcagctgcccgctaccaccag
tgtaacacaacctttggcaacgaggtgatctcagtgctggagcgagcccgcaaagccggg
aaggcagtgggcatcgtgacgactacacgggtgcagcatgcgtcaccctcggggacctac
gcccatgtggtggatcgcgactggtacgcggatgccagcatgcccgcggaggcccggagc
cagggctgcaaggacatcgcctggcagctgatccacaatgtcgacatcaatgtgatcatg
gggggtggtcggatttacatgacccctgcaggaacaccggaccctgagtatcccaactct
actctcatgaacggggtgcgcagggacgggaataacctcatcaacatgtggctggaggca
cggcagggtgcccgctatgtctggaacaggacagagatgctggctgctgctgctgacccc
aacgtgaactatttgatgggtctctttgaacccatggacatgacgtatgacatggcgcgt
gacaccaatctggacccatcacttgccgagatgacagaagcggccatcaccatcctgaaa
aggaaccccaatggcttctacctctttgtggaaggcggtagaatcgaccatggccaccac
gaaggggcagcccagaaggcgctgacagatgcggtggcgttcgaccgggccatcgaacgg
gcgggcatcgtgacagatgaggcagagaccctgactgttgtcactgccgaccactcccac
gtcttctcctttggtggctacaccctgcgcggctcctccatcttcagtctggcccccagc
gaagctgctgatgggaagagctacacgtccatcctctacgggaacgggccaggctacgtg
gaaggcaaccggactgatgtggatgagtccacagtcatgaatttcaactacagacaacag
gcggctgtgcccctcatctctgagacacacggtggcgaggacgtggccatcctggccaag
ggccccatggcttacctcttccacggggtgcaggagcagacctacatcgcccacgtcatg
gcctacgccgcctgcctcgagccctacactgactgtcgccagcgcacctctaacaccttc
tctgccgccagcgcccgcgctgtccccctgctcctgcccaccctcctcctgcccaccctc
ctcctgcccctcttccactga

DBGET integrated database retrieval system