KEGG   Columba livia (rock pigeon): 102092668Help
Entry
102092668         CDS       T02912                                 

Gene name
HDAC4
Definition
(RefSeq) histone deacetylase 4 isoform X4
  KO
K11406  histone deacetylase 4/5 [EC:3.5.1.98]
Organism
clv  Columba livia (rock pigeon)
Pathway
clv04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:clv00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    102092668 (HDAC4)
Enzymes [BR:clv01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     102092668 (HDAC4)
Chromosome [BR:clv03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     102092668 (HDAC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl HDAC4_Gln
Motif
Other DBs
NCBI-GeneID: 102092668
NCBI-ProteinID: XP_005509284
LinkDB All DBs
Position
Unknown
AA seq 1115 aa AA seqDB search
MLQSYSAEKREVVGFRHAALASRARYSCVFYAETQKDGLSGRDQPVELLNPPRVNHMPSS
VDVTTALPLQVAPTSVPMDLRLDHQFPMPVTEPTLREQQLQQELLALKQKQQIQRQILIA
EFQRQHEQLSRQHEAQLHEHIKQQQEMLAMKHQQELLEHQRKLEQHRQEQELEKQHREQK
LQQLKNKEKGKESAVASTEVKMKLQEFVLNKKKALAHRNLNHCISSDPRFWYGKTQHSSL
DQSSPPQSGVSGTYNHPVLGMYDSKDDFPLRKTASEPNLKLRSRLKQKVAERRSSPLLRR
KDGPVVTALKKRPLDVTDSACNSAPGSGPSSPNNSSNNISAENGIAGSVTSIQAETSLAH
RLVNREGSVTQLPLYTSPSLPNITLGLPATGPSSGGSAQQDAERLTIPTLQQRISLFPGT
HLTPYLSTTTLERDGGTAHNPLLQHMVLLEQPTAQTPLVTDWYLSGLPLHAQSLVGGERV
SPSIHKLRQHRPLGRTQSAPLPQNAQALQQLVIQQQHQQFLEKHKQQFQQQQLHINKIIS
KPNEPARQHESHPEETEEELREHQALLEEPYSDRVASQKEAPGLANVVQVKQEPIESDEE
EAEPQQELEAGQRQAEQELLFRQQALLLEQQRIHQLRNYQASLEAAGMPVSFGGHRPLSR
AQSSPASATFPMSVQEPPTKPRFTTGLVYDTLMLKHQCTCGNTNSHPEHAGRIQSIWSRL
QETGLRGKCECIRGRKATLEELQTVHSEAHTLLYGTNPLNRQKLDSKKLLGSLTSMFVRL
PCGGVGVDSDTIWNEVHSSGAARLAVGCVIELVFKVATGELKNGFAVVRPPGHHAEESTP
MGFCYFNSVAIAAKLLQQRLNVSKILIVDWDVHHGNGTQQAFYNDPNVLYISLHRYDDGN
FFPGSGAPDEVGTGAGVGFNVNMAFTGGLDPPMGDTEYLTAFRTVVMPIANEFAPDVVLV
SSGFDAVEGHPTPLGGYNLSAKCFGYLTKQLMGLAGGRVVLALEGGHDLTAICDASEACV
SALLGNELDPLPEKVFQQRANANAVHSMEKVIEIHSKYWHSLQRYSSTVGYSLVEAQKCE
NEEAETVTAMASLSVGVKAAEKRPDDEPMEEEPPL
NT seq 3348 nt NT seq  +upstreamnt  +downstreamnt
atgttacagtcctacagcgctgaaaagagggaggtggtcggcttcagacacgctgctctt
gcttccagggcgcgatatagctgtgtcttctacgcagagacgcagaaagatgggctttct
ggcagagaccagccagtagagctgttgaatccacctagagtgaaccacatgcctagctct
gttgatgtgaccacagcactgcccttgcaagttgcaccgacttcagtcccaatggacctg
cgcttggaccaccagtttcccatgcccgtgacggagccaacactgcgggagcagcagctg
cagcaggagctcctggcactgaagcagaagcagcagatccagagacagatcctcatcgcc
gagttccagcggcagcacgagcagctttcccggcagcacgaggcccagctgcatgaacac
atcaaacagcagcaggagatgctggcgatgaagcaccagcaggagctgttggagcaccag
aggaagctggagcagcaccgacaggagcaggagctggagaagcagcaccgagagcagaaa
ctgcagcagctaaaaaacaaagagaaaggaaaagagagtgcggtggcaagcacagaagta
aagatgaagttacaagaatttgtcttaaataagaagaaggcattggcacaccggaatctc
aaccactgtatatccagtgaccctcgcttctggtatgggaagacacagcacagctctctg
gaccagagctcccctccccaaagtggcgtatccggcacctacaatcaccctgtactgggg
atgtacgattccaaagatgacttcccgctcagaaaaacagcgtctgaacccaacctgaag
ttacgatccagactaaagcaaaaagttgctgaaaggcggagcagccccctcctgcgcaga
aaagatggtccggtggttactgctcttaagaagcgcccgctggatgtcacagactctgca
tgcaacagtgctcctggatctggtcccagctctccaaacaacagctccaataacataagc
gccgagaatggaattgcaggatcagtcacgagtattcaagcagagaccagcctggctcac
agacttgtgaatcgcgagggctcggtaacgcagcttccgctctacacgtctccgtctttg
cccaacatcacgctaggactacctgcaactggcccttccagcggaggatcagcacagcag
gatgcagagagactgactatcccaaccttacagcagcggatctctttgtttcctggcact
cacctcactccctacttgagcactacaacattggaaagagatgggggaaccgcacataac
cctcttctgcaacacatggtcttactggaacagccaactgcacaaacgcccttagtcaca
gactggtatctttcaggactgcccctccatgcacagtctctggttggtggagaacgggtc
tccccttcaatacacaaactccggcagcatcgcccgctggggcgcacgcagtctgctccc
cttccccagaacgcccaggccctccagcagttagtgatccagcagcagcaccagcagttc
ttggagaaacacaaacagcaattccagcaacagcaactgcacatcaacaagattatatca
aaacccaacgaaccagctcgccagcatgaaagccaccctgaggagacagaagaagagtta
cgggaacaccaagcccttttggaggagccatacagcgacagagtcgcgagccaaaaggag
gctccagggttggccaacgtggtgcaagtgaagcaagaacccatcgagagcgatgaggag
gaagcggagccgcagcaggagctggaggctgggcagaggcaggctgagcaggagctgctc
ttccgtcagcaagcccttctgttggagcagcagcgtatccaccagctgagaaactaccag
gcgtcgctggaggcagccggcatgcccgtctctttcggaggacatcggcccctgtcccgc
gcacagtcctcgcccgcctcggccaccttcccgatgtccgtacaggagccacccactaag
ccaaggttcacaacaggccttgtatatgacaccttgatgctaaaacaccagtgtacctgt
ggaaacacaaacagccacccagagcacgcagggaggatccagagcatctggtcccggctc
caggagacgggtctccgtggcaagtgtgagtgcattcgcggaagaaaagcaactctagaa
gagctgcagacagttcactcagaagcccatacgctgctgtacggcacaaaccctctgaac
agacagaaactggacagcaagaaacttctaggttctctaacgtcgatgtttgtcaggctt
ccttgcggtggtgtcggggtcgacagtgacacaatttggaatgaagttcactcgtctggt
gctgctcggctggccgtgggctgtgtcattgagctcgttttcaaagtggccacaggagaa
ctgaagaatggatttgctgttgttcggcctccaggtcaccacgcagaagagagcacaccc
atgggtttctgctattttaactctgtggcaattgcagccaagctgctccagcaaagactg
aatgttagcaaaatccttatagtggactgggatgttcaccatgggaatggtactcagcaa
gctttctacaatgatcctaatgttctttatatttcactacatcgctatgatgatgggaac
ttctttccaggcagtggtgctcccgatgaggttggcaccggagcaggagttggtttcaat
gttaacatggcctttactggtggccttgatccaccgatgggagacacagaatatttaact
gctttcagaacggtagtaatgcccattgccaacgaatttgccccagatgttgtgctggtg
tcatctggtttcgatgcggtggaaggccatcccacacctctcggaggatataatctatca
gcaaaatgtttcgggtacctgacgaagcagctgatgggcctggccgggggtcgcgttgtc
ctggccctggaaggaggccacgacctgacagccatttgtgatgcctcggaagcgtgtgtt
tctgctttgctggggaacgagcttgaccctcttccagaaaaggttttccagcagagggca
aatgctaatgcggtgcattcaatggaaaaagtaatcgagatacacagcaagtattggcat
tcactccagcgttactcctccacggtggggtactccctggttgaggcgcagaagtgcgag
aatgaggaggcggagacggtaacagccatggcgtccctgtcagtgggcgtgaaggcagct
gagaagagacctgatgatgaacccatggaagaggaacctcccctgtag

DBGET integrated database retrieval system