KEGG   Corynebacterium lactis: CLAC_02295Help
Entry
CLAC_02295        CDS       T04042                                 

Definition
(GenBank) alanine racemase
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
clw  Corynebacterium lactis
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:clw00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    CLAC_02295
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    CLAC_02295
Enzymes [BR:clw01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CLAC_02295
Peptidoglycan biosynthesis and degradation proteins [BR:clw01011]
 Precursor biosynthesis
  Racemase
   CLAC_02295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
533199..534851
Genome map
AA seq 550 aa AA seqDB search
MTSSQSPQPTVQPLLTQTVNLDAVAHNVATIKQISGVDEFMAVVKADGYSQGATQVARAA
IGGGATQLGVATLEEALSLCAALSDPLADAPAVPILAWIWDAAAVDLVRQAVEQEIELGI
PSVAHAHAVAQAGAVLGRRPRVTVMVDTGLGRSGISMANGDFDVAVGEVAQLHAEEKLLV
TGLFTHFACADEPQHPSVDRQAENFRAAIAALREAGVEGLVNHAANSPAALERPDLAFDM
VRPGLAIYGGEPVAGARHGLRPVMRWEAAVVLVKKLPKGESVSYGLTWTADRDTTVAVVP
CGYADGMMRSASGRFEVSIDGKRYPQVGRVCMDQFVVDLGPDSDVRTGDIAVIVGDPELG
EPGLDELANASGTINYEILTAPKGRTQRHWVHSRVVPTAEDMRYLGEEIGRTLRGGDLVI
MDGPLGAGKTTMTQGIARGMNVRGRVTSPTFTIAREHRPLDDGAPLIHVDAYRLFGEEGP
DSDGAAEPSAISAFDALDSLDLDTELEDSVVVAEWGTGLAEQLAENYLRITIDRSRADDT
RVVTWAWSRG
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
atgacttcttcgcagtctccgcagcctaccgtgcagccgctcctaacccagacagtcaac
ctcgatgcggtcgcgcataacgtcgccacgattaagcagattagcggcgtcgacgagttc
atggccgtggtcaaggcggacggctattcgcagggcgcgacgcaggtcgcccgcgctgcg
attggcggcggggctacgcagctgggtgtcgccacactggaggaggctctttcgctgtgc
gcagctctgtccgacccgcttgccgacgcccccgcggttccaatcctcgcctggatttgg
gatgcggcggcggtcgacctggtcaggcaggccgtggaacaggagattgagctgggcatc
ccgtcggtcgctcacgctcacgcggttgcgcaggctggcgcggtcctggggcgtaggccg
cgcgtaacggtcatggtggacacggggctcgggcgctccggaatttctatggccaatgga
gacttcgacgttgccgtaggcgaggtggcccagctgcatgctgaggagaagctgctggtc
accggtctgtttacccacttcgcttgcgcggacgagccgcagcatccgagcgtcgatagg
caggcggagaatttccgagccgcgattgcggcgctgcgcgaggcgggcgttgagggccta
gttaatcacgcggcgaactctccggcggcgctggagcggcccgacctggcgttcgacatg
gtgcggccgggactggccatctacggcggagagcccgtcgcgggtgcgcgccacggcctg
cgcccggtaatgcgctgggaggccgcggttgtgctggtcaagaagctgccgaagggagag
tcggtctcctacgggctgacttggaccgcggatcgagacacgactgtcgccgtcgtcccc
tgtggttatgccgacggcatgatgcgttcggcgtcggggcgcttcgaggtcagcatcgac
ggcaagcgatacccgcaggtcgggcgcgtgtgtatggatcagttcgtggtggacctcggc
ccggattccgatgtgcgcaccggcgacattgcggtcatagtcggtgacccggagctgggt
gagcctggcctggatgaactcgcgaatgcgtccgggacgatcaactacgagattctgacg
gccccgaagggtcgcacgcagcgccattgggtgcactcgcgtgtcgtgccgacggcagag
gacatgcgctacctcggcgaggaaatcggccgcaccctgcgcggaggggacctggtgatc
atggacgggccactcggtgcgggcaagaccaccatgactcagggcatcgcccgcggcatg
aacgtccggggtcgtgtgacctcgccgaccttcaccatcgcccgcgagcaccggccgctg
gacgatggcgcgccgctcatccacgtcgacgcctaccgcctgttcggggaggagggcccg
gattcggacggtgccgccgagccgagtgccatcagcgcattcgacgccctggactccctg
gacctggataccgagctggaggacagcgttgttgtcgcggaatggggcacgggcctggcc
gagcagctggcggagaactacctgcgcattaccatcgaccgctcgcgtgctgacgacacc
cgcgtggtcacgtgggcctggtcgcgtgggtaa

DBGET integrated database retrieval system