KEGG   Corynebacterium lactis: CLAC_05695Help
Entry
CLAC_05695        CDS       T04042                                 

Definition
(GenBank) polyphosphate glucokinase
  KO
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
clw  Corynebacterium lactis
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:clw00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLAC_05695
   00520 Amino sugar and nucleotide sugar metabolism
    CLAC_05695
Enzymes [BR:clw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     CLAC_05695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(1283394..1284149)
Genome map
AA seq 251 aa AA seqDB search
MTQRVGFGIDVGGSGIKGGRVDLDTGLLIGDRIKILTPKPATPDAVAKTIAEIVKIAQWD
GHVGITLPSVVQNQTALLAANIDGSWVNTDCQKLFSAHLPNNPAHVLNDADAAGLAEVQF
GNPENKTGSVMLLTFGTGIGSALIHDGKLYPNSELGHLVIDGTEAEHYASSKAKEDKDLS
YKKWAKRVSKVLSVYEALFWPSKFIVGGGISRKHEKWVPLLTCKTPVEPATLHNNAGIAG
AALAAEQGLYP
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgacacaacgagttggatttggtatcgacgtcgggggctccgggattaagggaggccgg
gttgacctcgacacgggtctcctcattggcgatcgcatcaagattttgacgccaaaaccc
gcgacccccgatgctgtggcaaaaacaatcgcggaaattgtgaagattgcgcagtgggat
ggccacgtcggaattacactgccctcggtggtccagaaccagacagcacttctcgccgca
aacatcgacggttcctgggtaaataccgactgccagaagcttttctctgcccacctaccc
aataacccagcgcatgtgcttaacgacgccgatgccgccggccttgccgaagtacagttc
ggcaacccagagaacaaaacgggatccgtaatgctcctgacattcggcactggaatcgga
tctgcgctaattcacgatggaaaattgtacccgaattccgaactcggccatttggtgatc
gatggcacagaagctgagcattatgcctcctccaaggccaaggaggacaaagacctcagc
tacaagaagtgggcgaagagagtttcgaaggtgctctcggtgtatgaggcactcttctgg
ccatccaagttcattgtgggtggcggcatcagccgtaagcatgagaaatgggttcctctg
ctgacctgtaagactccagtagaaccggcgacactgcacaataacgccggaatcgcagga
gcagcattggcggctgaacagggactttacccctaa

DBGET integrated database retrieval system