KEGG   Celeribacter manganoxidans: CBW24_13655Help
Entry
CBW24_13655       CDS       T05128                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
cmag  Celeribacter manganoxidans
Brite
Translation factors [BR:cmag03012]
 Eukaryotic Type
  Elongation factors
   CBW24_13655
 Prokaryotic Type
   CBW24_13655
Mitochondrial biogenesis [BR:cmag03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    CBW24_13655
Exosome [BR:cmag04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CBW24_13655
  Exosomal proteins of breast cancer cells
   CBW24_13655
  Exosomal proteins of colorectal cancer cells
   CBW24_13655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2979660..2980835)
Genome map
AA seq 391 aa AA seqDB search
MAKEKFARTKPHVNIGTVGHVDHGKTTLTAAITKYFGDFRAYDQIDGAPEEKARGITIST
AHVEYETEARHYAHVDCPGHADYVKNMITGAAQMDGGILVVNAADGPMPQTREHILLARQ
VGVPALVVFMNKVDQVDDEELLELVEMEIRELLSSYEFPGDDIPIVAGSALAAMEGRDPE
IGENKIRELMAAVDDYIPTPERAVDQPFLMPIEDVFSISGRGTVVTGRVERGVVNVGDEL
EIVGIRDTKKTTCTGVEMFRKLLDRGEAGDNIGALLRGIDREGVERGQVLCKPGSVKPHT
KFEAEAYILTKEEGGRHTPFFANYRPQFYFRTTDVTGTVTLPEGTEMVMPGDNLKFAVEL
IAPIAMEDGLRFAIREGGRTVGAGVVSKIIE
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atggctaaggaaaagtttgcgcgtacgaaaccgcatgtgaacatcggcaccgtgggtcac
gttgaccacggcaagacgacgctgacggctgcgatcacgaagtatttcggtgacttccgc
gcctatgaccagatcgacggcgcgcccgaagagaaggcccgcggcatcacgatctcgact
gcgcatgtggaatacgagaccgaagcgcgtcactacgcccatgtcgactgccccggccac
gctgactatgtgaagaacatgatcaccggtgcggcgcagatggacggcggcattctggtt
gtgaacgcagccgacggcccgatgccccagacccgcgagcacatcctgctggcccgtcag
gttggcgtgcccgcgctggtcgtgttcatgaacaaggtcgaccaggtggatgacgaggag
cttctggagctcgtcgagatggaaatccgcgaactgctgtcgtcctacgagttccccggc
gacgatatcccgatcgttgcgggctccgctctggcggcgatggaaggccgtgacccggaa
atcggcgagaacaagatccgcgaactgatggcggctgtcgacgactacatcccgacgccc
gagcgcgccgtggaccagccgttcctgatgccgatcgaagacgtgttctcgatctcgggc
cgcggcaccgttgtgaccggccgtgtcgagcgtggcgtcgtcaacgtgggtgacgaactg
gaaatcgtgggcatccgcgacaccaagaaaaccacctgcaccggcgtcgaaatgttccgc
aagctgctggatcgcggggaagccggcgacaacatcggcgccctgctgcgcggcatcgac
cgtgaaggcgtcgagcgtggtcaggttctgtgtaagccgggttcggtgaagccgcacacg
aagttcgaggccgaagcctacatcctcaccaaagaggaaggtggccgtcacactccgttc
tttgcgaactaccgcccgcagttctacttccggaccacggacgtcaccggcaccgtcacg
ctgcccgagggcaccgagatggtcatgcccggcgacaacctgaagttcgccgttgaactg
atcgcgccgatcgccatggaagacggtctgcgcttcgccatccgcgaaggcggccgcacc
gtcggcgccggcgtcgtctcgaaaatcatcgagtaa

DBGET integrated database retrieval system