KEGG   Croceicoccus marinus: A9D14_04045Help
Entry
A9D14_04045       CDS       T04890                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
cman  Croceicoccus marinus
Brite
Translation factors [BR:cman03012]
 Eukaryotic Type
  Elongation factors
   A9D14_04045
 Prokaryotic Type
   A9D14_04045
Mitochondrial biogenesis [BR:cman03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    A9D14_04045
Exosome [BR:cman04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   A9D14_04045
  Exosomal proteins of breast cancer cells
   A9D14_04045
  Exosomal proteins of colorectal cancer cells
   A9D14_04045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
837851..839041
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERNKPHCNIGTIGHVDHGKTTLTAAITKVLAEAYGGTAVDFANIDKAPEERERG
ITISTAHVEYETDARHYAHVDCPGHADYVKNMITGAAQMDGAILVVNAADGPMPQTREHI
LLARQVGVPALVVFMNKVDQVDDAELLELVELEIRELLSSYDFPGDDIPIVSGSALAALE
GRDDEIGKDKILELMKAVDDYIPQPARPVDKPFLMPVEDVFSISGRGTVVTGRVETGIVK
VGEEVEIVGLKDTRKTTVTGVEMFRKLLDQGEAGDNIGALVRGVAREDVERGQVLCKPGS
VNPHTEFSAEVYVLSKDEGGRHTPFFANYRPQFYFRTTDVTGEVILPEGTEMVMPGDNVT
IGVKLIAPIAMDEGLRFAIREGGRTVGSGVVSTITK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaagctaagtttgagcggaacaagccgcactgcaacatcggcaccatcggtcac
gtcgaccacggcaagacgacgctgaccgcagcgatcaccaaggtgctcgctgaggcatac
ggcggcaccgccgtcgacttcgcgaacatcgacaaggctcctgaagagcgtgagcgcggc
atcacgatttcgaccgcgcacgtcgaatatgaaaccgacgctcgccactatgcgcacgtc
gactgccccggccacgccgactatgtgaagaacatgatcaccggtgcggcgcagatggac
ggcgcgatcctggtggtgaacgctgccgacggcccgatgccccagacgcgcgagcacatc
ctgcttgcccgtcaggtcggcgtccccgctctggtcgtgtttatgaacaaggtcgatcag
gtcgacgacgcggaactgcttgaactcgtcgaactggaaatccgtgaactgctgtcgagc
tacgacttcccgggcgacgatattcctatcgtttcgggttcggctctcgccgctctggaa
ggccgcgacgacgaaatcggcaaggacaagatcctcgagctgatgaaggctgtcgacgac
tacattccgcagcccgctcgtcctgtcgacaagcccttcctgatgcccgtcgaggatgtg
ttctcgatctcgggtcgtggtacggtcgtgaccggccgcgtcgagaccggcatcgtcaag
gttggtgaggaagtcgagatcgtcggcctcaaggacactcgcaagaccaccgtcaccggc
gtcgaaatgttccgcaagctgctcgatcagggtgaagctggcgacaacatcggtgctctg
gttcgcggcgttgcccgtgaggatgtcgagcgtggccaggttctctgcaagcccggttcg
gtcaacccgcacaccgagttcagcgccgaagtctacgtgctatcgaaggacgaaggtggc
cgtcacacgccgttcttcgccaactatcgcccgcagttctacttccgcacgaccgacgtg
accggcgaagtgatcctccccgagggcaccgagatggtcatgcctggtgacaacgtcacc
atcggcgtgaagctgatcgctccgatcgcgatggacgaaggtcttcgcttcgcaattcgt
gaaggtggccggaccgtcggttcgggggttgtcagcaccatcacgaagtaa

DBGET integrated database retrieval system