KEGG   Cucurbita maxima (winter squash): 111477770Help
Entry
111477770         CDS       T05246                                 

Definition
(RefSeq) histone-lysine N-methyltransferase, H3 lysine-9 specific SUVH1-like
  KO
K11420  euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
cmax  Cucurbita maxima (winter squash)
Pathway
cmax00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:cmax00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    111477770
Enzymes [BR:cmax01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     111477770
Chromosome [BR:cmax03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     111477770
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SAD_SRA Pre-SET SET
Motif
Other DBs
NCBI-GeneID: 111477770
NCBI-ProteinID: XP_022977424
LinkDB All DBs
Position
Unknown
AA seq 713 aa AA seqDB search
MEQHLDQDSIPVAGSLDKSKVLNVKPLRQLVPVFPSAQNVSSFSNPQGAAPFVCTGPSGP
FPPGVAPFYPFFFSPNEQNQQTPGGTPNSSAPFGLNSPISTAVPISSFRTPTEGTSTQNT
GSRKNARSRGQLQGYSDSQNDDSQYFGMGINDREDSSKAGRKKKAKKKARNGQDINFTSD
IDIDAMLNDMVSSYNLSMLDSNQQTHGSNEAVSSVLMVYELLRRRISQVEESKEPTPGII
RRPDLKTGAFLMTKGIRSNINKRIGTVPGVEVGDIFFFRMELCLVGLHAPSMAGIDYMGL
KVSQDEEPVAVSIVSSGGYEDDTNDADVLIYSGQGGVNRKDKESTDQKLERGNLALEKSL
HRGNEVRVIRGVKDFSNPTGKIYVYDGLYKIQESWVEKGKSGCNVFKYKLVRLPGQREAF
LTWKLVQQWKDGNASRVGVIIPDLASGAESLPVSLVNDVDDEKGPAYFTYDSGLKYLKPV
YSMEPSAGCNCVGGCLPGNLNCLCIQKNGGYLPYGSNGVLASQQSMIYECGPSCQCPPNC
RNRVSQGGLKFRLEVFRTKGKGWGLRSWDPIRAGAFICQYAGEVIDSSKEKDSARDNEDG
YIFDATRSYPNLEVISGDSDGPPRLPFPLVISAKNVGNVARFMNHSCSPNVYWKPIIREN
KGEHDVHIAFHAIRHVPPMMELTFDYGIVPPESADGRKINCLCGSSKCRGFFC
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atggagcaacatctggatcaggattccattcccgtcgctgggtcattagacaaatctaag
gtattgaatgtaaaaccgttgcgtcaactagttccagtcttcccatcagcacaaaacgtg
tcgtctttttcaaatcctcaaggtgctgccccatttgtgtgtactggtccttctggtcct
tttccacctggggttgctccattctatcccttcttcttttcaccaaatgaacaaaatcaa
cagacaccaggtggaacaccgaattctagtgcaccttttggtctaaatagtcctatatca
accgcagttccaatttcgtcattcaggacaccaactgagggtacttcaacacagaatact
ggctctagaaaaaacgctagaagtcgtggccagttgcaagggtatagtgatagtcaaaat
gatgattctcagtattttggcatgggtataaatgatagagaagattcaagtaaagcggga
aggaagaagaaggcgaagaagaaggcaaggaatggtcaggatattaattttacatcagat
atcgatattgatgcaatgcttaatgatatggtttcatcgtacaatctttcaatgttagat
tctaatcaacaaactcatggtagcaacgaagcagtttctagtgtactcatggtatatgaa
ctgctaaggagaaggatctcacaagttgaagagtctaaggaaccaacgcctggaattata
aggcgtccagatctaaaaacaggtgcatttctgatgaccaaaggaattaggtcaaatatc
aataaaaggattggaacagttcctggtgtggaagttggtgatatcttctttttcaggatg
gaattgtgcctggtcgggttgcatgctccatcgatggctgggattgattacatgggttta
aaggtcagtcaagatgaagaaccagttgcagtaagcattgtctcgtctggtggatacgag
gatgatactaatgatgcagatgtgttaatctacagtggtcagggtggagtgaacagaaag
gataaggaatcaacagatcaaaagctcgaaaggggtaatcttgctctagagaagagcttg
catcgtggaaatgaagtcagagtaattcgaggggtaaaagactttagtaacccaacaggg
aagatctatgtttatgatggtctatataaaatccaggaatcttgggtagagaaagggaaa
tctggctgcaatgtatttaaatacaaattggtccgattacctggacagcgggaagcattt
ttgacttggaaattagtacaacaatggaaggatgggaatgcttctcgagttggggttata
ataccagatctggcttctggcgcagaaagtttacccgtttcacttgtaaatgatgttgat
gatgagaagggccctgcgtatttcacatatgattctggtctcaaatatttaaaaccagtg
tactcgatggaaccttcagctggttgtaactgtgttggtggatgccttccaggcaatctc
aattgcctttgcatacagaaaaatggtggatatctcccctatggttcaaatggggttctt
gcaagtcaacaatctatgatttatgaatgtggaccctcatgtcaatgccctcccaattgc
aggaatcgtgtgtcccaaggaggccttaaattccgcctagaggtattcagaactaaaggt
aaaggctggggactaaggtcgtgggatccgattcgtgctggagcatttatttgccaatat
gctggggaagtcatcgatagttcaaaggaaaaggactctgcacgggacaatgaagatggt
tatatcttcgatgccacacgttcatatccgaaccttgaagttatatctggtgattccgat
gggcctcctaggctcccatttcccttagttattagtgcaaaaaatgtgggcaatgtcgct
cgttttatgaaccatagttgctctccaaacgtatactggaagccaattattcgggaaaat
aaaggcgagcatgatgtccatattgcctttcatgcaatcaggcatgtacctcccatgatg
gagttgacgttcgattatggaatagtcccacctgaaagtgctgatggaaggaagatcaat
tgcctatgtgggtcttcaaaatgtagaggcttcttctgttaa

DBGET integrated database retrieval system