KEGG   Clavibacter michiganensis subsp. nebraskensis: CMN_02529Help
Entry
CMN_02529         CDS       T02530                                 

Gene name
alr2
Definition
(GenBank) alanine racemase/kinase fusion protein
  KO
K01775  
alanine racemase [EC:5.1.1.1]
Organism
cmc  Clavibacter michiganensis subsp. nebraskensis
Pathway
D-Alanine metabolism
Metabolic pathways
Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:cmc00001]
 Metabolism
  Metabolism of other amino acids
   00473 D-Alanine metabolism
    CMN_02529 (alr2)
 Human Diseases
  Drug resistance
   01502 Vancomycin resistance
    CMN_02529 (alr2)
Enzymes [BR:cmc01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     CMN_02529 (alr2)
Peptidoglycan biosynthesis and degradation proteins [BR:cmc01011]
 Precursor biosynthesis
  Racemase
   CMN_02529 (alr2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(2683218..2684906)
Genome map
AA seq 562 aa AA seqDB search
MSDAVPAPVPAGPVAPGRRAVIDLDAIRHNVRTLAALAAPARTMIAVKADAYGHGALQVA
RAALEAGAESLAVLDVASAVELRRAGIDARLLAWLHGVDTDFRVAVEHGIDLGVSALWEL
ERIAAAGRATGMRARVHLKADTGLSRNGATPEAWPDLVRAAVAADAAGELTLHALWSHLA
DASPEDDDAALARFREAVRVAEELGARPVEKHLAASSAGIRLPAARFDMVRFGIAVYGIS
PFDDRSGRDLGLVPAMTLEADVVSVKRVPAGHGVSYGLDHRTAGPSTLVLVPLGYADGIP
RIAAPHASVLLNGRRFPIAGRIAMDQLVLDVGDLPVEVGDTAVILGPGHRGEPTAEEWAG
WAETIGDEIVTRVGPRVDRVHLHERAAADAEAPAAELLSDVLVPVATTDDMEEVGRAVAR
ELGAGDLVVLSGPLGAGKTTFTRGLGDGLGVRGPVTSPTFVLARTHPSLVDGPPLVHVDA
YRLADARELDDLDIDFARSVVVVEWGEGKLDGVAEEWWDLRIARPTGAGDADADPDADAD
PDAAPEEPRTVRIRRLRARPRA
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgccgtccccgcgcccgtcccggccggccccgtcgcgcccggccgtcgtgcc
gtgatcgacctcgacgcgatccgccacaacgtccgcacgctcgccgcgctcgccgccccc
gcgcgcacgatgatcgccgtgaaggccgacgcgtacggacacggcgccctgcaggtcgcg
cgcgccgccctcgaggcgggcgccgagagcctcgccgtgctcgacgtggcctccgccgtc
gagctccgccgcgccgggatcgacgcgcgtctcctcgcctggctgcacggcgtcgacacc
gacttccgcgtcgcggtcgagcacggcatcgacctgggcgtctcggcgctgtgggagctg
gagcgcatcgcggccgcgggacgcgccacggggatgcgcgcccgcgtgcacctcaaggcc
gacacgggcctcagccgcaacggcgccaccccggaagcgtggcccgacctggtgcgcgcg
gccgtcgccgccgatgccgcgggcgagctgacgctgcacgcgctctggtcgcacctcgcc
gacgcctcgcccgaggacgacgacgccgcgctcgcccgcttccgtgaggccgtccgcgtg
gccgaggagctgggcgcgcggccggtcgagaagcacctggccgccagctccgcggggatc
cgcctgcccgccgcccgcttcgacatggtgcgcttcggcatcgccgtctacggcatctcg
ccgttcgacgaccgctccggtcgcgacctcggcctcgtccccgcgatgacgctcgaggcc
gacgtcgtctccgtcaagcgcgtcccggcggggcacggcgtctcgtacggcctcgaccac
cgcaccgcggggccgtcgacgctcgtgctcgtgccgctcgggtacgccgacgggatcccg
cgcatcgccgccccgcacgcctccgtgctgctgaacggccgccgcttcccgatcgccggc
cgcatcgccatggaccagctcgtgctcgacgtcggcgacctgcccgtcgaggtgggggac
accgccgtgatcctcggccccggccaccgcggcgagcccaccgccgaggagtgggccggc
tgggccgagaccatcggcgacgagatcgtgacccgcgtcggcccccgcgtcgaccgcgtg
cacctgcacgagcgggcggccgccgacgcggaggcgccggccgccgagctcctctccgac
gtgctcgtccccgtcgcgaccacggacgacatggaggaggtcggccgcgccgtcgcgcgc
gagctgggcgcgggcgacctcgtcgtcctctccggcccgctcggcgcgggcaagaccacg
ttcacgcgcgggctcggcgacggcctcggcgtccgtggccccgtcacgagccccacgttc
gtgctcgcgcgcacgcacccgagcctcgtcgacggcccgccgctcgtgcacgtcgacgcc
taccgcctggccgacgcccgcgagctcgacgacctcgacatcgacttcgcgcgctcggtc
gtggtggtcgagtggggcgagggcaagctcgacggcgtcgcggaagagtggtgggacctg
cggatcgcgcggcccacgggcgcgggcgacgccgacgcggatcccgacgccgacgcggat
cccgacgccgctcccgaggagccccgcaccgtccgcatccgacggctccgcgcgcggccc
cgcgcctag

DBGET integrated database retrieval system