KEGG   Corynebacterium maris: B841_01370Help
Entry
B841_01370        CDS       T02784                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cmd  Corynebacterium maris
Pathway
cmd00620  Pyruvate metabolism
cmd00680  Methane metabolism
cmd01100  Metabolic pathways
cmd01120  Microbial metabolism in diverse environments
cmd01200  Carbon metabolism
Module
cmd_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cmd00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    B841_01370
  Energy metabolism
   00680 Methane metabolism
    B841_01370
Enzymes [BR:cmd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     B841_01370
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase
Motif
Other DBs
NCBI-ProteinID: AGS33757
UniProt: S5SRV5
LinkDB All DBs
Position
complement(284433..287177)
Genome map
AA seq 914 aa AA seqDB search
MSDQVRDDIRLLGRILGRVIAEQEGEDIYELVEDTRRRAFAVARGEEDPESLLAIFRTVD
EHKINLVARSFSYFALMANIAEDLDDETSLAQREDAGEAAPAASLDGVLAKLREADSVTP
GDVAQMLRTAQVSPVLTAHPTETRRRTVFDVQKRIIHLLRERHGLINRPETPRRRNRLSE
IEREIHLRMTLLWQTALIRIARPQIEDEVNVGLRYFKLSLLEEVPAINRDVLAGLREVFG
TEVPSTQIVRTGSWIGGDHDGNPFVTGETLTYATRKAADTVLGHYVEELGELERELSLSD
RYSDSSAELQELAARGRNDVPSRVDEPYRRAIHGVHGRIRATRAVVAGDTAADGHEPYAS
PQEFLADLDVIDRSLREFSDAIIADDRLLRIRSAVESFGFHLNALDLRQNSESFEAVLDE
LFAAAGVVRGYAGLNEEEKRKVLTEELASARPLTFSWAEPFSEPTERELGIFRAAADAVN
LLGPEVIPHCIVSMTGTVSDVLEPMVLLKEVGLINFDAAQGRLVGSVDVAPLFETIDDLK
AGAAILEELWDVPLYRQYLRGRGDLQEVVLGYSDSNKDGGYLSANWALYDAELAVVEACA
ARGINLRFSHGRGGAVGRGGGPTYDAILAQPKGAVQGSIRITEQGEVISARYGQNSTARR
HLEAFVAGTLEASLLDTESLQESERAYGIMREIAELAGEKYADLIRRDPGFIDYFTQSTP
LHEIGDLNMGSRPTARKQTSSVADLRAIPWVLSWSQSRVNLPGWFGVGTGVTRWAGDDEA
RWQDLRTLYRAWPFFRSVLDNMAQVMGKASMDLAQMYSRLVDDPEVSRRIFQTISDEYEL
TREIFRRITGHESLMAGNERLERSVYRRYPYLLPLNAIQVELLRRYRAGDDSFLVSKTIQ
VTMNGLATGLRTSG
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgatcaggttcgcgacgacatccgcctcctcggccgcattctcggccgagtcatc
gccgagcaggagggcgaggacatatacgagctggtggaggacacccggcggcgggcgttc
gcggtggcccgcggggaggaggacccggagtcgttgttggcgattttccgcaccgtcgac
gagcacaagatcaacctggtcgcccgctcgttcagctacttcgcgctgatggccaacatc
gcggaggacttggacgacgagacctcgctggcgcagcgggaagacgccggggaagccgcc
cctgccgcgtcgctggacggggtgctggccaagctgcgggaggcggattcggtgaccccg
ggggacgtggcgcagatgctgcgcaccgcccaggtgtcgccggtgttgaccgcacacccg
acggagacgcgccgccgcacggtctttgacgtgcaaaagcgcatcattcacctgctgcgg
gagcgccacggcctgatcaaccggccggagaccccgcggcggcgcaaccgcttgagcgag
atcgagcgtgagatccatctgcgcatgaccttgttatggcagacggcgttgatccgcatc
gcgcgtccgcagatcgaggacgaggtcaacgtgggcctgcgctatttcaagctgagcctg
ctggaggaggttccggcgatcaaccgcgacgtgctggccgggctgcgggaggtcttcggc
acggaggtgccgagcacgcagatcgtgcgcaccggttcctggatcggcggcgaccacgac
ggcaacccgtttgtcacgggcgagacgctgacgtatgccacccgcaaggccgcagacacg
gtgctgggccactacgtggaggagctcggcgagctggagcgggagctgagcctgtccgac
cggtactcggacagctccgcggagctgcaggagctggccgcgcgcgggcgcaacgacgtg
cccagccgggtggacgagccttatcgacgcgcgattcacggcgtccacggccgcatccgc
gccacccgcgccgtcgtcgccggggacaccgccgccgacggccacgagccgtatgcctcc
ccgcaggagtttttggcggatctggacgtcatcgaccgctcgctgcgcgagttcagcgac
gcgatcatcgccgacgaccgcctgctgcgcatccgctccgccgtggagtccttcggcttc
cacctcaacgctttggacctgcgccagaactcggagtctttcgaggccgtgctggacgag
cttttcgccgccgccggcgtggtccgcggctacgcgggactcaacgaggaggagaagcgc
aaggtgctgaccgaggagctcgcctcggcgcgcccgctgaccttctcctgggcggaaccg
ttcagcgaaccgaccgaacgtgagctgggcatcttccgcgcggcggccgacgccgtgaat
ctcctcggcccggaggtcatcccgcactgcatcgtctccatgacgggcacggtcagcgac
gtcttggaaccgatggtgttgctcaaggaagtcgggctgatcaacttcgacgcggcgcag
ggccggttggtcggctccgtggacgtcgccccgctgtttgagacgatcgacgacctcaag
gccggcgccgccatcttggaggagctgtgggacgtgccgctgtaccgccagtacctgcgc
gggcgcggcgatctccaggaagtcgtgctggggtattccgactccaacaaggacggcggc
tacctctcggcgaactgggcgctgtacgacgccgagctcgccgtcgtggaggcgtgcgcc
gcccgcggcatcaacctgcgcttctcccacggccgcggcggggccgtcggccggggcggc
gggccgacctacgacgcgatcctggcccagcccaaaggcgcggtgcagggctccatccgc
atcaccgagcagggcgaggtcatctccgcgcgctacgggcaaaactccacggcgcgcagg
cacctggaggccttcgtcgcgggcacgctggaggcctccttgctggacaccgagtcgctg
caggaatcggagcgcgcctacgggatcatgcgcgagatcgccgagctggccggggaaaag
tacgccgacctgatccgccgggacccgggcttcatcgactacttcacccagtcgaccccg
ctgcacgagatcggggacctgaacatgggctcgcgcccgaccgctcgcaagcagacttcc
tcggtcgccgatctacgcgcgatcccgtgggtgctgtcctggtcgcagtcgcgggtgaac
ctgccgggctggttcggcgtcggcaccggcgtgacccgctgggcaggcgacgacgaggcc
cgctggcaggacctgcggaccctctaccgggcgtggccgtttttccgttcggtgctggac
aacatggcccaggtcatgggcaaggcgtcgatggacctggcgcagatgtactcgcgcctg
gtcgatgacccggaggtctcacgtcgcatcttccagaccatctccgacgagtacgagctg
acccgcgaaatcttccggcgcatcaccggccacgaatcactcatggccggcaacgaacgc
ctggagcgctccgtgtaccggcgctacccgtatctgctgccgctcaacgccatccaggtg
gagctgctgcgccgctaccgcgccggggacgattccttcctggtgtccaagaccatccag
gtgaccatgaacggcctggccaccggcctgcgcacctccgggtag

DBGET integrated database retrieval system