KEGG   Corynebacterium maris: B841_02475Help
Entry
B841_02475        CDS       T02784                                 

Definition
(GenBank) elongation factor Tu
  KO
K02358  
elongation factor Tu
Organism
cmd  Corynebacterium maris
Brite
Translation factors [BR:cmd03012]
 Eukaryotic Type
  Elongation factors
   B841_02475
 Prokaryotic Type
   B841_02475
Mitochondrial biogenesis [BR:cmd03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    B841_02475
Exosome [BR:cmd04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   B841_02475
  Exosomal proteins of breast cancer cells
   B841_02475
  Exosomal proteins of colorectal cancer cells
   B841_02475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
541138..542328
Genome map
AA seq 396 aa AA seqDB search
MAKAKFERNKPHLNIGTIGHVDHGKTTTTAAITKVLADLYPEENASFDYDQIDKAPEEKE
RGITINISHVEYNTPKRHYAHVDAPGHADYIKNMITGAAQMDGAILVVAATDGPMPQTRE
HVLLARQVGVPYILVALNKCDMVDDEEIIELVEMEVRELLAEQDYDEEAPIVQISALGAL
NGEEKWVNSVGELMEACDESIPDPERETDKPFLMPIEDIFTISGRGTVVTGRVERGSLNV
NDEIEIVGIKDKSTKTTVTSIEMFNKFLDSAEAGDNAALLLRGLKREDVERGQVVIKPGA
YTPHKKFEGSVYILSKDEGGRHTPFFDNYRPQFYFRTTDVTGVVTLPEGTEMVMPGDNVD
MSVELIQPVAMDEGLRFAIREGSRTVGAGRVTKIVE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaaggcgaagttcgagcgtaacaagccgcacctcaacatcggcaccatcggtcac
gtcgaccacggcaagaccaccaccacggctgccatcaccaaggttctggccgacctgtac
ccggaggagaacgcttccttcgactacgaccagatcgacaaggctccggaggagaaggag
cgtggcatcacgatcaacatctcccacgtcgagtacaacaccccgaagcgtcactacgca
cacgttgacgccccgggtcacgccgactacatcaagaacatgatcaccggtgccgctcag
atggacggcgccatcctggtcgtcgccgcaaccgacggcccgatgccgcagacccgcgag
cacgtcctcctggcccgccaggtcggcgtcccgtacatcctcgtcgccctgaacaagtgc
gacatggttgacgatgaggaaatcatcgagctcgtcgagatggaggtccgcgagctgctg
gccgagcaggactacgacgaggaagcaccgatcgtccagatctccgctctcggcgccctg
aacggcgaagagaagtgggtcaactccgtcggcgagctcatggaagcctgcgacgagtcc
atcccggacccggagcgcgagaccgacaagccgttcctgatgccgatcgaggacatcttc
accatttccggccgcggcaccgtcgtgaccggccgcgtcgagcgtggctccctgaacgtc
aacgatgagatcgagatcgtcggcatcaaggacaagtccaccaagaccacggtgacctcc
atcgagatgttcaacaagttcctggactccgctgaggccggcgacaacgccgctctgctg
ctccgcggcctcaagcgcgaggacgtcgagcgtggccaggtcgtcatcaagccgggcgct
tacaccccgcacaagaagttcgagggctccgtctacatcctgtccaaggatgagggcggc
cgccacaccccgttcttcgacaactaccgtccgcagttctacttccgcaccaccgacgtc
accggcgtcgtgaccctgccggaaggcaccgagatggtcatgccgggcgacaacgtcgac
atgtccgtcgagctgatccagccggtcgccatggacgagggcctgcgcttcgctatccgc
gagggctcccgcaccgtcggcgctggccgcgtcaccaagatcgtcgagtaa

DBGET integrated database retrieval system