KEGG   Cyanidioschyzon merolae: CYME_CME095CHelp
Entry
CYME_CME095C      CDS       T00175                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cme  Cyanidioschyzon merolae
Pathway
Pyruvate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Carbon metabolism
Module
CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cme00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CYME_CME095C
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    CYME_CME095C
Enzymes [BR:cme01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CYME_CME095C
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
5:265338..268157
Genome map
AA seq 939 aa AA seqDB search
MNSSLMKRVDSVDFTSPLQANVELLTSLLVSVVEQHCGEAVAGAFEKVRTLSRLYDLTHE
EKHFEELWSLVQELPIDDLVKICSTFSNLCNLTNIADHVHRIRRRRAYERGESSFLLHYG
AAETFEYLVKAGFTPEEIYRNLCNQTIDMVLTAHPTQSVRRSLLSKLHSIGMLLIELDRN
DLTPQERDLLHMRIEAEMNALWRTDEVRRSRPKPEDEARAALNVITSTVWDSVPRFLRLL
DIALRKIGIEGGIPLDCRPFVFSSWAGGDRDGNPNVTAQVTWETVLLNRFRAAELFLEAI
ESLMFDLSLHYCSPELRKYIQTLPEPQLVEKGARISLIYREFSHHVPPSEPYRQVLAHVR
DRVRLTRDYFGALLSQNHALADQIDPSIVLTHEEELLEPLRQIYASLLAESDVAVARAGL
TDLIRRVQAFGLSLLRLDIRQEASMHTETMDAITRYIGGGLKPYTEMTEAERMAFLSETL
QGRRPLIPRDGIPDCSAAVQEVLRTFEVCAKISREISTTALGAYVISMCMEPSDVLCVEV
LQREFAPKRPQRVVPLLETIGALQKATELLTSLFEVPWYREHLRSDHDNVQEVMIGYSDS
GKDGGRITSAWELYLGQERLAQTARKYGVHLRFFHGRGGTVGRGGGPQHLAIMSQPPDTI
NKYLRVTIQGEVIQQDFGMPALADRTLETFTTAVLRQELMPFRNVHPKWREIMDRMSHVS
CEHYRSIVYKQPNFVRYFRCATPEPELGILNIGSRPQKRREGGVETLRAIPWVFSWSQNR
LQLPVWLGIGDAIEDAIERGDGDTLRKMYLEWPFFRSFMDLIEMVLAKADTHIAAKYDEV
LVPDPDMHAIGSELRRRLQHTIALVMRVSGSRRLLDNDRPQQRAIDARRPWLTPMNLAQV
RALKLMRTAAAQQSEPESNVTDLFVISVKALAAGLQNTG
NT seq 2820 nt NT seq  +upstreamnt  +downstreamnt
atgaatagttctctcatgaaacgtgtcgattcagtcgactttacctccccgttgcaggct
aacgtcgagttgctgacctcgttgctggtgagcgtcgtcgaacagcactgcggtgaggca
gtcgcgggagctttcgagaaagtgagaacgctgtcgcgtctctacgacctcacgcacgaa
gaaaagcactttgaggaactgtggtcgcttgtgcaagagctcccgattgatgatctcgtg
aaaatctgttctactttcagcaacctgtgcaacttgacgaacattgcagaccatgtgcac
cgcatccgccgccgccgagcttacgagcggggcgagtcctcgttcctcttgcactacggc
gccgcggaaaccttcgagtacctggtcaaggcaggcttcactcctgaggagatctatcgc
aatttatgcaaccagacgatcgatatggttttgacggcgcacccgacgcagtcggtgcga
cgctcgctgctaagcaagctgcacagcattggaatgctgctcattgagctggatcgcaac
gacttgaccccacaggagcgagatctcttgcacatgcggattgaagcagaaatgaatgcc
ttatggcggacagatgaggttcgacgcagtcgtccgaagccggaagacgaagcgcgggcc
gccctcaatgtcatcacgtctacggtatgggactctgttccgcgtttcctacggctgttg
gatattgcgctccgcaagattggtatcgagggggggataccccttgattgtcgtccgttc
gtgttttcctcgtgggccggcggcgatcgcgacgggaaccccaacgtgaccgctcaagtg
acttgggagacggtgctccttaatcgtttccgcgctgcagagctcttccttgaggcgatc
gagagcctaatgtttgatctctcgctgcattactgtagccccgagctgcgcaagtacatt
cagacgttacccgagccacagctggttgaaaaaggcgcccgaatatctctcatatatcgc
gagttttcgcaccacgtaccaccatcggaaccttatcgacaggttctggcccacgtgcgt
gatcgagtacgtctcacgagagactatttcggggcattgctctcccaaaatcatgcgtta
gcggatcagatcgatcccagcattgtgcttacccacgaagaagagctactggagccactg
cgccaaatctacgcctccttgctagccgagagtgacgttgcggtggctcgcgcaggactc
accgaccttatccgccgtgttcaggcctttggtttatcacttttgcgcctcgatattcgt
caagaggcgagcatgcataccgaaaccatggacgcaatcactcggtatatcggcggcggg
ttgaagccgtacaccgagatgaccgaagcagaacggatggcgtttctgtcggagacgctg
caaggacgccgcccactcattccccgcgacggcataccggactgcagcgctgccgtccag
gaggtcttgcgtacctttgaggtatgcgcgaaaatctcccgtgagatatccaccaccgcg
ctcggtgcctacgtcatttcgatgtgcatggagccgagcgacgtcctctgtgtggaggta
ctccaacgcgagttcgcaccaaaacggcctcagagggtggtaccgctcctcgagaccatc
ggagcgttgcagaaggctactgaattgttgacaagcctgtttgaagtgccgtggtaccgc
gagcacctcaggagcgaccacgacaatgttcaggaggtcatgatcggttacagcgacagt
ggcaaggacggtggtcgaatcacctcggcgtgggagctttatcttggccaagagcgtctg
gcccagactgcccgaaagtacggcgtgcacttgcgcttctttcacggtcgcggaggcacc
gtgggccgcggcggtgggccccagcacctcgcgatcatgtcacagccgccggataccatc
aacaagtatttgcgggtaaccatccagggagaagtcattcagcaggatttcggaatgccg
gcccttgcggatcgtacgctggaaaccttcacaacagcagttctccggcaagaactgatg
cctttccgcaacgtacatcccaagtggcgtgaaatcatggaccgcatgagccacgtgagc
tgtgagcactatcgttcgatcgtctacaagcaaccgaactttgtgcgctatttccggtgc
gctacaccagaacctgagctcggcatcctgaacattgggtcacgaccccagaagcgacgc
gaaggtggcgtggaaacgctgcgggcgataccatgggtcttcagttggagccaaaatcga
ctccagttaccggtctggctgggcatcggcgacgccatcgaggatgccatcgagcgaggc
gatggcgacacccttcgcaaaatgtacctcgaatggcccttcttccggtcgtttatggac
cttattgaaatggtgctcgcaaaggccgatacccatatcgctgccaagtacgacgaggtg
ctggttccggatcccgacatgcacgccattgggtcagagctgcggaggcggctccagcat
accatcgctttggtgatgcgcgtgtcgggctctcggcgtcttctcgataacgaccgtcca
cagcaacgagcgattgatgcgcggcggccttggttgacccccatgaacttggcacaagtg
cgagcgctgaaactcatgcgcactgcagcagcgcaacagagcgagccggagtcgaacgtc
accgatttgtttgtgattagtgtcaaggcgttggcggcaggcctgcagaacaccggttaa

DBGET integrated database retrieval system