KEGG   Clavibacter insidiosus: VO01_02775Help
Entry
VO01_02775        CDS       T03862                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
cmh  Clavibacter insidiosus
Pathway
cmh00010  Glycolysis / Gluconeogenesis
cmh00030  Pentose phosphate pathway
cmh00051  Fructose and mannose metabolism
cmh00052  Galactose metabolism
cmh00680  Methane metabolism
cmh01100  Metabolic pathways
cmh01110  Biosynthesis of secondary metabolites
cmh01120  Microbial metabolism in diverse environments
cmh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cmh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VO01_02775
   00030 Pentose phosphate pathway
    VO01_02775
   00051 Fructose and mannose metabolism
    VO01_02775
   00052 Galactose metabolism
    VO01_02775
  Energy metabolism
   00680 Methane metabolism
    VO01_02775
Enzymes [BR:cmh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     VO01_02775
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     VO01_02775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase Peripla_BP_4
Motif
Other DBs
NCBI-ProteinID: AJW78188
UniProt: A0A0D5CEW1
LinkDB All DBs
Position
complement(560278..561303)
Genome map
AA seq 341 aa AA seqDB search
MRIGILTSGGDCPGLNAVIRGAVLKGTTIHKQEFVGFRDGWRGVVDGDVMPLARRDIQGI
GKQGGTILGTSRTNPFEGDGGVERIQENLDRLGIDAILAIGGEGTLAAAKRLTDAGLKIV
GVPKTVDNDLDATDYTFGFDTAVQIATDAMDRLRTTGDSHSRCMVAEVMGRHVGWIALHS
GMAAGAHAILIPEQKTSMDEIIGWVRSAYDRGRAPLVVVAEGFIPEHASDAHGERGLDAF
GRPRLGGIGEQIAPIIEERTGIETRATTLGHIQRGGTPSSYDRVLATRLGLAAVDSVRDG
HWGRMVALRGTDIVHVGFEEALGRLKTVPQHRYDEAAILFG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcatcggaatcctcacctcaggcggagactgccccggactcaacgcggtcatccgc
ggggcggtgctcaagggaacgaccatccacaagcaggagttcgtgggcttccgcgacggc
tggcggggtgtcgtcgacggcgacgtcatgccgctcgcgcgccgcgacatccagggcatc
ggcaagcagggcggcacgatcctcggcaccagccgcacgaacccgttcgagggcgacggc
ggcgtggagcggatccaggagaacctcgaccgcctcggcatcgacgccatcctcgccatc
ggcggcgagggcacgctcgcggccgcgaagcgcctcaccgacgcgggcctcaagatcgtg
ggcgtccccaagaccgtcgacaacgacctcgacgccaccgactacacgttcggcttcgac
accgcggtgcagatcgcgaccgacgccatggaccgcctccgcaccacgggcgactcgcac
agccgctgcatggtggccgaggtcatgggccggcacgtcggctggatcgcgctgcactcc
ggcatggccgcgggcgcgcacgcgatcctcatccccgagcagaagacgagcatggacgag
atcatcggctgggtccgctccgcctacgaccgcgggcgcgcgccgctcgtcgtcgtcgcg
gagggattcatccccgagcacgcgtcggacgcgcacggcgagcgcgggctcgacgccttc
ggccgcccgcggctcggcggcatcggcgagcagatcgcgcccatcatcgaggagcgcacg
ggcatcgagacccgcgcgacgaccctcggccacatccagcgcggcggcaccccgtcgtcg
tacgaccgcgtgctcgccacccgcctcggcctcgccgcggtcgacagcgtgcgtgacggg
cactggggccgcatggtcgcgctccgcggcaccgacatcgtccacgtgggcttcgaggag
gcgctcggccgcctcaagaccgtgccgcagcaccgctacgacgaggccgcgatcctcttc
ggctga

DBGET integrated database retrieval system