KEGG   Clavibacter michiganensis subsp. michiganensis: CMM_0383Help
Entry
CMM_0383          CDS       T00529                                 

Gene name
ppcA
Definition
(GenBank) phosphoenolpyruvate carboxylase (ZP_00293827.1| COG2352: Phosphoenolpyruvate carboxylase [Thermobifida fusca]; NP_695792.1| phosphoenolpyruvate carboxylase [Bifidobacterium longum NCC2705]). pfam00311, PEPcase,Phosphoenolpyruvate carboxylase.; High confidence in function and specificity
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cmi  Clavibacter michiganensis subsp. michiganensis
Pathway
Pyruvate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cmi00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CMM_0383 (ppcA)
  Energy metabolism
   00680 Methane metabolism
    CMM_0383 (ppcA)
Enzymes [BR:cmi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     CMM_0383 (ppcA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
461542..464274
Genome map
AA seq 910 aa AA seqDB search
MTTPPKKPLPLEHDSTRDGTRDAVEPALRSDVSHLGGLLGQVLRESGGDDLLRDVERLRE
LVIDAYESARDASIDDAERLVATFTPERAEQVARAFTCYFHLANLAEEHHRVRVLREREA
AAGFVPDSIPDAVGKLTEELGREEAMRRLGEMRFHPVLTAHPTEARRRAVATGIRRIGDL
LTERDGAMAGTLTGADVDRRLLEEIDGLWRTTPLRTTRPTPLDEVRTAMGVFDQTLFEVV
PRVYRLLDDWLLGDEAGVRDAVAPAFFRLGNWIAADRDGNPYVTAAVTEEAAGIASEHIL
LGLERVALRVGRSLTLGDADTPPSAELRELAAAQDALAPHLTARIGTRAPAELHRRVLLV
IAGRLSATRERHDDPIAYPSAAELLADLRVLQASLRSAGAHRIAGGELQGLVWQAETFGF
HLAEMEVRQHSQVHREALREVLAVAAADASGDQAPELAPMTVEVLDVFRTLARLQERHGV
APFSRFIVSFTQSADDIRTVHELAALALGSAEAAPVLDVIPLFETFADLNASTEILDGMI
RLPQVAARLAQTGRKLEVMLGYSDSSKDVGPVSATFALFDAQARIAAWARENDIELTLFH
GRGGALGRGGGPADRAVRAQPPGSVDGRFKLTEQGEVIFAHYGDKRIAARHIEQMAAATL
LASAPSNEERNAVAAEGSAEMVRTMDEASRARFFELVKAPGFAPWFAQVTPMEEIGLLAL
GSRPARRGLSVESLEDLRAIPWVFAWTQARINLTGWFGLGSALAAVGDEAVLRKAYEEWP
LFTSMIDNVEMSLAKTDGRLAERYLALGDRPDLAALVTEEMERTREWVRKATGRGEILEG
RPVLRRAVRLRSPYVDALSLLQLRALRALRTSASEAAGQGAPGQADPTDPDHRLLLLTVN
GIAAGLQNTG
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
gtgacgactcccccgaagaagccgcttcccctcgagcacgactccacccgcgacggcacg
cgcgacgccgtcgagccggcgctccgctccgacgtcagccacctcggcggcctcctcggc
caggtgctccgcgagtccggcggggatgacctgctgcgcgacgtggagcgcctgcgcgag
ctggtcatcgacgcgtacgagagcgcgcgcgacgcctccatcgacgacgccgagcggctc
gtcgcgacgttcacgcccgagcgcgcggagcaggtcgcccgcgcgttcacctgctacttc
cacctcgcgaacctcgccgaggagcaccaccgcgtgcgcgtgctccgcgagcgcgaggcc
gcggcgggcttcgtgcccgactccatcccggacgcggtcggcaagctcaccgaggagctc
ggccgcgaggaggccatgcgccgcctcggcgagatgcggttccacccggtgctcacggcg
caccccaccgaggcgcgtcggcgggcggtggccacggggatccgccgcatcggcgacctg
ctcaccgagcgcgacggcgcgatggcgggcacgctcaccggcgcggacgtcgaccgccgg
ctgctcgaggagatcgacggcctgtggcgcaccacgccgctgcgcaccacgcgtcccacc
ccgctcgacgaggtccgcacggccatgggcgtcttcgaccagaccctgttcgaggtcgtg
ccgcgcgtctaccgcctgctcgacgactggctcctgggcgacgaggcgggcgtgcgcgac
gcggtcgcgcccgcgttcttccggctcggcaactggatcgcggcggatcgcgacggcaac
ccctacgtcacggccgccgtcaccgaggaggccgcgggcatcgccagcgagcacatcctc
ctcgggctggagcgcgtcgccctccgcgtcggccgttcgctcacgctcggcgacgccgac
accccgccgagcgccgagctgcgggagcttgccgccgcgcaggacgcgctcgcgccgcac
ctcaccgcccgcatcggcacgcgcgccccggccgagctgcaccgccgcgtgctcctcgtg
atcgccggccgcctctccgccacgcgcgagcgccacgacgaccccatcgcctacccgtcc
gccgccgagctgctcgccgacctgcgcgtgctgcaggcgtcgctccgcagcgcgggcgcg
caccgcatcgcgggcggcgagctgcagggcctcgtctggcaggcggagaccttcgggttc
cacctcgccgagatggaggtgcgccagcactcgcaggtgcaccgcgaggcgctccgcgag
gtcctcgccgtcgccgcggcggacgcgtccggcgaccaggcgcccgagctcgcgcccatg
acggtcgaggtgctcgacgtgttccgcacgctcgcgcgcctccaggagcggcacggcgtc
gcgccgttctcgcgcttcatcgtctcgttcacgcagtcggccgacgacatccgcacggtg
cacgagctggccgcgctcgccctcggctcggcggaggccgcgcccgtcctcgacgtcatc
ccgctgttcgagacgttcgctgacctgaacgcgagcacggagatcctcgacggcatgatc
cgcctgccccaggtggcggcgcgcctcgcgcagacgggccggaagctcgaggtcatgctc
gggtactccgactcgtcgaaggacgtcgggcccgtctccgcgacgttcgcgctgttcgac
gcgcaggcgcgcatcgccgcgtgggcgcgcgagaacgacatcgagctcacgctcttccac
ggccgcggcggcgccctcggccggggtggcggcccggccgaccgcgccgtgcgggcccag
ccgccgggatccgtcgacggccgcttcaagctcaccgagcagggcgaggtgatcttcgcc
cactacggcgacaagcgcatcgccgcccgccacatcgagcagatggccgccgcgaccctg
ctggcctccgcgccctcgaacgaggagcgcaacgcggtggccgccgaggggtccgccgag
atggtccgcacgatggacgaggcctcgcgcgcccgcttcttcgagctcgtgaaggcgccc
ggcttcgcgccgtggttcgcgcaggtcacgcccatggaggagatcgggctgctcgcgctc
ggttcgcggcccgcccgccgcggcctgtccgtcgagtcgctcgaggacctgcgggcgatc
ccgtgggtgttcgcgtggacgcaggcgcgcatcaacctcaccggctggttcggcctggga
tccgcgctggccgccgtcggcgacgaggccgtgctccgcaaggcgtacgaggagtggccg
ctgttcacgtcgatgatcgacaacgtcgagatgtcgctcgccaagaccgacggccgcctc
gcggagcgctacctcgcgctcggcgaccggccggatctcgcggcgctcgtcaccgaggag
atggagcgcacgcgcgagtgggtgcgcaaggcgacgggtcgcggcgagatcctcgagggc
cggccggtcctgcgccgggcggtgcgcctgcgcagcccgtacgtcgacgcgctctcgctg
ctgcagctccgggcgctccgggcgctgcgcacctcggcttccgaggcggcgggccagggt
gcacccggccaggccgacccgacggatccggaccaccggctcctgctgctcacggtcaac
ggcatcgcagcggggctgcagaacacggggtga

DBGET integrated database retrieval system