KEGG   Callorhinchus milii (elephant shark): 103176378Help
Entry
103176378         CDS       T03088                                 

Gene name
b3galt1
Definition
(RefSeq) beta-1,3-galactosyltransferase 1
  KO
K07819  beta-1,3-galactosyltransferase 1 [EC:2.4.1.86]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk00601  Glycosphingolipid biosynthesis - lacto and neolacto series
cmk01100  Metabolic pathways
Module
cmk_M00070  Glycosphingolipid biosynthesis, lacto-series, LacCer => Lc4Cer
Brite
KEGG Orthology (KO) [BR:cmk00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    103176378 (b3galt1)
Enzymes [BR:cmk01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.86  N-acetyl-beta-D-glucosaminide beta-(1,3)-galactosyltransferase
     103176378 (b3galt1)
Glycosyltransferases [BR:cmk01003]
 Glycan extension
  Type 1 chain
   103176378 (b3galt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Galactosyl_T
Motif
Other DBs
NCBI-GeneID: 103176378
NCBI-ProteinID: XP_007888054
LinkDB All DBs
Position
Un
AA seq 328 aa AA seqDB search
MPSKASCLYILTVVCWASVLWYLSATRPSSTYVGQHSFSQITFVRKDSNFSFSNIRTRPM
NPHSFNYLINEPRKCEDASPFLVILISTTHKDFDARQAIRETWGDENNFKGIQMVTLFLL
GKNVDNVLNEMVEQESQIFHDIIVEDFVDSYHNLTLKTLMGMKWIATFCSKAKYVMKTDS
DIFVNMENLINKLLKPNTKPRRRYFTGYVINGGPIRDMRSKWYMPRDLYPDSNYPPFCSG
TGYVFSADVAEAIYKVSLHTRLLHLEDVYVGLCLHKLGIHPFQNSGFNHWKITYSLCRYR
RIITVHQIPPEEMHRIWNEMSSKKHLRC
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgccttcaaaagcctcctgtttatatatcttgacagtggtgtgttgggctagtgtcctc
tggtacttgagtgccaccagaccctcgtccacttacgtgggacagcactcgttctcacag
atcaccttcgtgagaaaagattccaatttcagcttcagtaacattcgaacccggccaatg
aacccacatagtttcaattatctcatcaacgagccccgtaaatgtgaggacgccagccct
ttcttggtgatcctgatcagcactacacacaaggactttgatgcgcgtcaggccatcagg
gaaacctggggagatgagaacaatttcaaagggatacagatggtcacgttgtttttgctg
ggcaagaacgtagacaatgtcctgaatgagatggtcgaacaagagagtcagatcttccat
gatatcattgttgaggactttgtggactcctaccacaatctgactttgaaaactttaatg
ggcatgaagtggatagccacattttgctcgaaagccaagtacgtgatgaaaaccgacagt
gatatatttgtgaatatggagaatctgatcaataaattgctcaagcccaataccaagcca
cggagaaggtactttactggctacgtgatcaatggaggacctatacgagacatgcgcagt
aagtggtacatgcccagagatttatacccagacagtaattaccctccgttctgttcggga
acaggttacgtattttcggcagacgtggctgaagctatttacaaagtgtctcttcacacc
aggctgcttcatctcgaggatgtgtatgtcggactttgcctgcataagttgggcatccat
ccctttcagaacagtgggttcaatcactggaagataacctacagcctgtgtaggtaccgg
agaataattacagtgcaccagatcccaccagaggaaatgcacaggatttggaatgagatg
tcgagcaaaaaacatcttcgatgctga

DBGET integrated database retrieval system