KEGG   Callorhinchus milii (elephant shark): 103178906Help
Entry
103178906         CDS       T03088                                 

Gene name
sod2
Definition
(RefSeq) superoxide dismutase 2
  KO
K04564  
superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
FoxO signaling pathway
Peroxisome
Brite
KEGG Orthology (KO) [BR:cmk00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    103178906 (sod2)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    103178906 (sod2)
Enzymes [BR:cmk01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     103178906 (sod2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Un
AA seq 223 aa AA seqDB search
MLRALTFRRCTYTISPVLRCLASRQKHTLPDLPYDYGALEPHVGAEIMQLHHSKHHATYV
NNLNVTEEKYAESLAKGDVSTQVFLQPALRFNGGGHINHSIFWTNLSPNGGGEPSGELMA
AIKRDFGTFEKLKEKMSTISVGVQGSGWGWLGYNKDAGRLQLAACPNQDPLQGTTGLIPL
LGIDVWEHAYYLQYKNVRPDYVKAIWNIINWENVAQRFNAAKK
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgctccgcgcactcaccttccgcagatgtacttacaccatttctccagtcttgcgctgt
ttggcctcgaggcaaaagcacaccctgcctgatctgccttatgactatggtgcactggaa
ccacatgttggtgcagaaatcatgcaactgcatcacagcaaacatcatgctacttatgtg
aataatttaaatgtcacagaggagaagtatgcagagtccttggctaaaggtgatgtgagc
actcaggtgtttttgcagccagcattgcgatttaatggtgggggccatattaatcattct
attttctggaccaatctgtctcctaatggtggcggagaaccttcaggggagctgatggca
gccatcaaacgtgactttggtacttttgagaagcttaaggagaagatgtctaccatttca
gtaggtgttcagggttcaggctggggatggctcggttacaacaaggatgctggaaggctg
cagctagctgcttgtccaaatcaggacccattgcaaggaacaacaggtctaatccctcta
cttggaatagatgtgtgggagcatgcctactacctgcaatacaagaatgtgcggccagac
tatgtaaaagccatttggaatattatcaattgggagaatgtagcacagagattcaatgct
gccaagaagtga

DBGET integrated database retrieval system