KEGG   Callorhinchus milii (elephant shark): 103179983Help
Entry
103179983         CDS       T03088                                 

Gene name
ptgs2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk00590  Arachidonic acid metabolism
cmk01100  Metabolic pathways
cmk04370  VEGF signaling pathway
cmk04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:cmk00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    103179983 (ptgs2)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    103179983 (ptgs2)
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    103179983 (ptgs2)
Enzymes [BR:cmk01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     103179983 (ptgs2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF hEGF
Motif
Other DBs
NCBI-GeneID: 103179983
NCBI-ProteinID: XP_007893749
LinkDB All DBs
Position
Un
AA seq 655 aa AA seqDB search
MLNCIKQGLWEPAEAEAELKWIAVQVTEKFFHKSKETKADADSRRSTMYLAASLFLAALL
SVNQAANPCCSHPCQNQGVCTTVGFDGYECDCTRTGFYGENCTNPEFWTWVKLSLKPSPN
TVHYILTHYSGLWNFINSISFLRDAIMRYVLTSRSHLIDSPPTYNAKYGYKSWEAYANIS
YFTRTLPPIPEDCPTPMGVVGKKVLPDPKYLAERFLMRKKFIPDPQKTNMMFAFFAQHFT
HQFFKTDQSRGAAFTKGLGHGVDLSHVYGETLVEQYKLRLFKDGKLKYQVINGDVYPPIV
KEAPVDMTYPPHVPEHLRFAVGQEFFGLVPGLMMYATIWLREHNRVCDILKVEHPDWEDE
QLFQTSRLILIGETIKIVIEDYVQHLSGYNFKLKFDPELLFNQHFQYSNRIASEFNMLYH
WHPLMPDTFDIQNKAYSYREFLFNNTVLLEHGISNMVSSFSKQIAGRVAGGRNMNPALLN
VAIANIKHSRELRYQSMNEYRKRFLMKPYVSFEDLTGEKEMAAELRELYGDIDAMELYPG
LMIEKPRPGAIFGETMVEMGAPFSLKGLMGNPICSPQYWKPSTFGGNVGFDIVNTFSLQK
LICNNVKGPCPFVTFSVPESTASNSGSPSSDSSNTGLEDVNPQGHVLLKERSVEL
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgctgaactgcataaagcaggggctttgggaaccagcagaggcagaagctgagttgaag
tggatcgcagtgcaagtcacagagaagttcttccacaagtcgaaagaaacaaaagcagac
gcagattccagacgctcaaccatgtatttagcagcctctctcttcctggctgctctactc
tcagtgaatcaagcagcgaatccttgctgctctcatccctgccagaaccaaggggtctgc
accacggtgggcttcgatggctatgaatgcgattgcacacggaccggattttacggcgag
aactgcaccaatcctgaattctggacttgggtgaaattgtccttgaagccttctcccaac
actgtgcattacatcctcacccactattctggattgtggaactttataaacagcatatct
ttcctgagggacgccatcatgcgttatgtgctaacgtcccgatctcatttgatcgacagt
ccacctacctacaacgcaaaatatggttacaaaagctgggaagcttatgccaatatcagc
tacttcaccagaaccctgcccccaatccccgaagactgcccgactccaatgggagtagtt
ggaaagaaagttctgcccgatcccaagtatttagcggagcggttccttatgaggaagaag
ttcatccctgatcctcagaagaccaacatgatgtttgccttcttcgcacagcatttcacc
catcagttttttaagacagaccagagccgaggagcagccttcactaaagggttaggtcat
ggggttgacctaagtcatgtgtacggagaaacgttagtcgaacaatacaagctgagactg
tttaaagacgggaaactcaagtaccaggttatcaatggagacgtttatcctcccatcgta
aaggaagcccccgtagacatgacctaccctcctcatgtgccggagcacttgcgctttgct
gtgggccaggaattctttggtctggttccaggcctgatgatgtacgcaacgatctggctg
cgggagcacaaccgagtgtgtgacatcttgaaagtcgagcaccccgactgggaggatgag
cagctcttccagaccagccgactcatcctgataggagagaccatcaaaatagtcattgaa
gattatgtgcagcatctgagtggctataacttcaagctgaaatttgatcccgagcttctc
tttaaccaacacttccaatacagcaaccgcattgcctcagagttcaacatgctctaccac
tggcaccccctgatgccggacacctttgatattcagaataaggcatacagctaccgggaa
ttcctctttaacaacacagttctgctggaacacggcatctccaatatggtttcttcgttc
tccaagcagattgctggaagggttgctggcggcaggaacatgaatccagcattgctcaat
gtggccatcgcaaacatcaaacacagccgcgagcttcgctaccagtctatgaacgaatac
aggaagcgctttttaatgaagccttacgtgtcttttgaagacctcacaggtgagaaagaa
atggcagctgagctgagggaactgtatggagatattgatgcaatggagttgtaccctggt
ctgatgatagagaaaccaagacctggagccatttttggagaaaccatggtcgagatgggc
gcccctttctctttgaagggtttaatgggaaaccctatctgctcgcctcaatactggaaa
cccagcacttttggtgggaatgtcggctttgacatcgtgaacaccttttcactgcagaag
ctgatctgcaacaatgtgaagggtccttgcccattcgtcacattcagcgttcctgaatct
acagccagcaattcaggttctcccagctccgattcgtccaacacaggtctggaagatgtt
aatccacagggtcatgtactgctgaaagaacgatcagtggaactttaa

DBGET integrated database retrieval system