KEGG   Callorhinchus milii (elephant shark): 103183116Help
Entry
103183116         CDS       T03088                                 

Gene name
nsd2, whsc1
Definition
(RefSeq) nuclear receptor binding SET domain protein 2
  KO
K11424  
histone-lysine N-methyltransferase NSD2 [EC:2.1.1.43]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:cmk00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    103183116 (nsd2)
Enzymes [BR:cmk01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     103183116 (nsd2)
Chromosome [BR:cmk03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     103183116 (nsd2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 1442 aa AA seqDB search
MAQPCRFIGNPLPLAQDLLNPISMKQVPEILGIANRKSQNGEMDSEHSLLPDKTATQLSA
ALQDGVMHRLNGHDATSAYRSDKLKDLTALMLNGDSGAVQEPLSVQASSPVDCSIENRGS
ETPPHTTPKKSGSPEIKLRITKTYLNGKPLFESSLCGDLQIDDPEIIEHQQNVEEKEENQ
ERRKRKRKRSVKYDALLEQNLAEVALVSKTSNTPDADEKIAKEDLEEEEERDEETKEKDK
EKDVPVKYNVGDMVWSKVSGYPWWACMISSDPLLNTHTKVKGLNRAIGRQYHVQFFGEAP
ERAWIFEKSIVPFEGAQQYDQLIQDCAKHATSKAEKNKLLKPIPAKIRVQWDVGISQAEE
ALMMTPEDRKAKYTFVYDHDRPLLPPQVAKETGVPVERIEGRKYPAEESLSTKENFADSR
GSRKRNSSVPNKNRRCSKPSESQKTPTKQCINRTVEPSEGSPSERTVCRSSDSESGTGSP
MTKRKSGAPTQRIRKCDTAFAQFMAFCQKHRDELAEEHPDASSEEIEELLESQWAMLSDK
QRARYNTKFSLVTPVTDHKSPAASGFSAASPGATRRKVLQDSPKRTTRSSVSSDSTRQRR
LSRKIVDYREDSPERIGSNRRLKRDYYEDEKYDSNNANQTEASVSDGIEAGETSSVVNAP
QNSQSDISKLSDACKPLKKRSRASTTETLAPAVSKNPSPLTVFTENETSFDGQLESADES
ADETPTEASSVSSKKSQGERGGSAAAKKESVCQVCENAGELLFCEGQCCGAFHLTCLGLS
KMPQGKFMCSECLSGVHTCFVCKKNGPDVKRCIVPLCGKFYHEDCVRKYPPTVFENKRFR
CPLHSCISCHATNATNPSNPRVTKGRMMRCVRCPVAYHGGETCIAAGSVVLAANSIICTS
HFVPKKGYSHHAHVNVSWCFVCSKGGSLLCCESCPAAFHPECLNIDMPEGSWYCNDCKAG
KKPHYKDIIWVKLGSYRWWPAEICHPRSVPTNIQNMKHEIGEFPVHFFGSNDYFWTHRAR
VFPYMEGDKGCKDNKIKGLSKAFKKALQEAGDRFQDLKAQRETREAQENERNGRKPPPYK
PIKINKSFGRVQIYTADISEIPRCNCKPTDDNPCGLDSECLNRMLMYECHPSVCPAAGQC
QNQCFTKRQYPETQVVKTVGKGWGLISKTGIKKGVFVNEYIGEVIDEDECRARIRFAQEH
DIANFYMLTLDKDRIIDAGPKGNYSRFMNHSCQPNCETQKWTVNGETRVGLFSVCDIPAG
IELTFNYNLDCLGNEKTICKCGAPNCSGFLGVRPKTASNGSDDKGKRGKKKIRKRKTKHE
GRKEHEDECFRCRDGGQLVLCDRKICSKAYHLSCLSLTKPPFGKWECPWHHCDVCGKLSV
VFCQFCPNSFCKDHQKETVFKSKLDGRPCCSEHDHCNTAEPLEQCKKMETVLSLKDTVKS
ES
NT seq 4329 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaccttgccgatttatcggaaatcctttgccgctagcacaggatttgcttaat
cccatatctatgaagcaggtgcctgagatcctcggcattgcaaacagaaagagtcagaat
ggtgaaatggattccgagcactcattgctgcctgacaaaactgccacacaactatctgct
gcccttcaggatggtgtgatgcaccgattaaatgggcacgatgcgacttctgcttacaga
tcggacaaactgaaggatttgactgcccttatgttaaatggagattcgggtgcagttcaa
gaaccactatctgtacaggcatcttctcctgttgattgctccatagagaatagagggagt
gaaacaccgcctcacaccactcctaaaaagagtggctcaccagagattaaattgaggatt
actaaaacctatttgaatggaaaacccctttttgaatcttcactttgtggagatctccaa
attgatgatcctgagattatagaacaccagcagaatgtggaggagaaagaagaaaatcaa
gagagaagaaagaggaagaggaagagaagtgtaaagtatgatgctcttcttgagcagaat
ctggctgaggtggctcttgtgtccaagacatccaatactcctgatgcagatgaaaaaatt
gctaaagaagacctagaggaggaagaagaaagggatgaggaaacaaaagaaaaagacaaa
gaaaaagatgtcccagtgaagtataatgttggagacatggtgtggtccaaggtttctggt
tacccttggtgggcctgtatgatttcttcagatcccctgttgaatacccacacaaaagtg
aaaggtctgaacagggcaattggtcgtcagtaccatgttcagttttttggagaagccccg
gaaagagcttggatttttgagaagagtatagtgcccttcgaaggagctcaacagtatgac
cagttgatccaagactgcgccaaacatgcaacttccaaagctgagaaaaacaagctttta
aaaccaattcctgccaaaatacgtgttcagtgggatgtaggcatttcccaagctgaagaa
gcactgatgatgactcccgaggaccgaaaagctaaatatacttttgtctacgatcatgac
cgcccactactacctcctcaggttgcaaaagaaactggggttcctgttgaacgtatagaa
ggcaggaaataccctgctgaagaatctctaagtactaaagaaaattttgcggacagtaga
ggatccagaaaaagaaatagtagcgtgccaaataagaacaggcgatgttccaaaccatcc
gagtctcaaaagactccaactaagcaatgtataaatcggactgtagaacccagtgaaggt
tctccatctgaaaggacagtttgtagatcttcagactctgagagtggaactggctcccca
atgactaagagaaaatctggagcacccactcagcggatcaggaaatgtgatactgccttc
gctcagttcatggccttttgtcagaaacaccgagatgagttagctgaagagcatccagat
gcttccagtgaagagattgaagagctgctcgagtctcagtgggctatgcttagtgataag
cagagagctcggtacaataccaagttttctttagtgactccagtaactgatcacaaatct
cctgcagcttcaggattttcagcagcatctcctggagctaccagacgtaaagtgttgcaa
gattccccaaagagaacaactagatcaagtgttagttcagattcaactcgacaaagaaga
ctgtccaggaaaatagtagattacagggaggattctccagagcgaattggctctaacaga
agattaaagcgtgattactacgaggatgaaaagtatgattccaataatgcaaaccaaact
gaggcatctgtaagtgatggtattgaggctggagaaacctcttctgttgttaacgcaccc
caaaacagccagtcagatataagcaaactttctgatgcatgtaaaccactgaaaaagaga
agtcgagcatctactacagaaactctggcaccagctgtcagcaagaatccatctccttta
actgtgtttacagaaaatgagacatcatttgatgggcagctggagtcagcagatgaaagt
gcagatgagactccaacagaggcttcatctgtgtcatccaaaaaatcccaaggagagcga
ggaggcagtgcagcagctaagaaagaaagtgtttgtcaggtgtgcgagaatgctggggaa
ctgctcttttgtgaaggacaatgttgtggggcttttcacttgacctgtctcgggctgtct
aaaatgcctcaaggcaaattcatgtgcagtgaatgcctgtcaggtgttcacacttgtttt
gtgtgtaagaagaatgggcctgatgttaaacgttgcattgttcctctgtgtggcaagttc
taccacgaggactgtgtgagaaaataccccccaactgtgtttgagaacaagagatttcga
tgcccactgcacagttgtatcagctgccatgccacaaacgccacaaacccctctaacccc
agggtaacaaaaggaagaatgatgcggtgtgtccgctgtcctgttgcttatcatggagga
gagacctgtattgcggcaggttctgtggtgctggcagcaaacagtattatctgcaccagc
cattttgttccaaaaaagggctatagtcaccatgctcatgttaatgtcagctggtgcttt
gtgtgttcaaaagggggcagcctgttgtgctgtgagtcctgtccagccgcatttcacccg
gagtgcctcaatattgacatgccagaaggcagctggtattgcaatgattgcaaagcaggc
aagaaaccacactataaagacatcatatgggtgaaactgggaagctataggtggtggcca
gcagagatctgccacccaaggagcgttcccacaaacattcagaatatgaaacatgagatt
ggagagtttccagttcatttctttggatcaaacgactacttttggactcatcgggcacgt
gtgtttccctatatggaaggggataaaggatgcaaagacaacaaaatcaaaggcctcagc
aaagccttcaaaaaagctttacaggaagctggagaccgttttcaggatctcaaagctcag
cgagagacgagagaggctcaggaaaatgagcgcaatggtagaaaacctccaccgtataaa
cccataaagatcaataaatcttttggaagagtgcagatatacacagctgatatttcagag
atcccaaggtgcaactgtaagcctactgatgacaacccatgtggcctggattcagagtgt
ctgaacagaatgttaatgtatgaatgtcatccatctgtctgcccagctgctggacaatgc
caaaaccagtgctttaccaaacgtcaataccctgaaactcaggttgtcaaaactgttgga
aagggttggggcctgatttcaaagacaggtataaaaaagggagtatttgtaaatgagtac
attggagaagtgattgacgaggatgagtgccgagcaagaattcgatttgcccaggaacat
gatatcgccaatttctacatgctcactcttgataaggaccgaataattgatgctggtcca
aaagggaactattctcgctttatgaaccatagttgtcagcccaactgtgaaacacagaaa
tggactgtgaatggagagactcgggttggactattttctgtctgtgacattccagcaggg
attgagctcacctttaattacaacctagactgtcttggcaacgagaagactatctgcaaa
tgtggtgcacccaattgcagtggattcctcggagttagaccaaagactgcaagcaatggt
tcggatgacaaaggaaaaaggggaaagaagaaaatccgaaaacgtaaaactaaacatgaa
ggaaggaaagagcatgaagatgaatgttttcgctgcagagatggaggacagcttgtactg
tgtgacagaaaaatctgttcgaaggcttatcacctatcctgtctcagtcttacaaaacct
ccatttgggaagtgggagtgcccctggcaccactgtgatgtctgcggaaagctttctgtt
gttttttgccagttctgccccaactctttctgcaaggaccatcagaaagagacagtcttc
aagtccaaactagatggacgtccttgctgctccgaacatgaccactgcaacacagcagaa
cctctggaacaatgcaaaaaaatggagaccgtcctttctctgaaggacacagtgaaatca
gagtcttaa

DBGET integrated database retrieval system