KEGG   Callorhinchus milii (elephant shark): 103185078Help
Entry
103185078         CDS       T03088                                 

Definition
(RefSeq) collagen alpha-1(IX) chain-like
Organism
cmk  Callorhinchus milii (elephant shark)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 918 aa AA seqDB search
MAASKAKIFAIPGRIRELCLIIYFLIVLHSLHVSCEEYSGYVSGDGDKHAFEGSVAGDLH
REPSEFIESGSVPFEEEMSGDDFVITATHIPDITESGSGLYPEMLVPDPDDVYAIASGYP
DISETGSTGPAVEMSTNKGYPYTTPTVSYTTVKEVITSTRIFPFSYSREMPQVEEELLPV
PDVGQKEVTDVLDTLKILSIPGINVVEGSKIGLTAYRLERSIQIGKETRFVHPYGFPKEF
SLVSTFRMREDTPEMVWNLWEVTDRNGDEQLRLRLYGETNAVEVYNVAAVGEEITIFENI
GQLFDGAWHKLSLSAKRNQLTLLVDCQQVGTAPIRQYGSITTDGFTSLATAAKADSTLLV
DLQQFKIYSNPNKAADERCCEIPGICDALGIETASAECDCVAAMSGFPGFPGSKGYEGEE
GTNGFPGPQGRKGYQGFKGAQGRRGDQGERGEEGIEGSEGDPGYSGAIGLPGLPGENGVA
GEPGQKGSVGLPGPRGEPGSKGENGDIGIVGEEGRPGPSGEKGSRGKPGAIGSPGAMGPK
GFPGELGFSGDAGDHGYMGYPGLIGQRGPQGRKGAVGLSGISGIDGEPGKDGLLGVPGLA
GETGQIGAKGNRGDPGPRGPQGLRGLQGPKGNAGEPGIPGKPGAQGIKGLPGPQGETGPD
GQKGETGKVGLEGKQGSQGDEGDIGDEGQQGQRGTPGLFGIDGRRGVPGIPGPRGFPGSM
GESGEPGPAGEPGSEGSQGPGMPDEQVYELCKSVINEQIAIYASAIRRTCMTACPTNNVT
LMGPPGPSGLPGKPGEQGKPGLDGLEGERGPRGRIGFAGSQGAPGAKGDQGDKGEKGAQG
VGLPGPEGFQGPRGYPGYPGVDKEGKPGPRGPVGYTGAPGQLGLPGNPGIPGICEARDCG
IHAAALQAQQGLLKGPGY
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atggcagcttcaaaagcaaagatttttgccatacctgggaggatacgtgaactgtgtcta
attatttatttcctcattgttctgcattcacttcatgttagttgtgaagagtattccggc
tatgtttctggagatggtgacaagcatgcctttgaagggtcagtagctggagacttacac
agagagccatcagaattcatcgagtcaggaagcgttccctttgaggaagaaatgtctggc
gatgactttgtaatcacagcaacacatatcccagatattactgaaagtggatcaggactt
tatcctgaaatgttagtaccagatcctgatgacgtttacgccatcgcttctggatatcca
gacatttcagaaactggttccactgggcccgcggtagagatgagcacaaataaaggctat
ccttacactaccccgacagtttcttatactactgtcaaagaggtcatcaccagcacaaga
atattcccattcagctattccagagaaatgccgcaggtggaggaggagttgctgccagtc
cctgatgtgggacagaaggaagttactgatgtgctagatacattaaaaatattgagcata
ccaggaattaatgtagtggaaggatccaaaataggcctaacagcctatcgcctagaaaga
agtatacagattgggaaagaaacaagatttgttcatccatatggattccccaaagaattc
tcattggtctcgaccttcagaatgagagaagacactcctgagatggtgtggaatctatgg
gaagtgaccgatagaaacggggatgagcagctccgacttcgcctgtatggagagacgaat
gcagttgaagtctacaatgtggcagctgtgggagaggagatcaccatctttgagaacata
ggacagctgtttgatggggcctggcacaagctgtcattaagcgccaaaaggaaccagtta
actttgcttgttgactgtcagcaggttggcacagcccccattagacagtatggatctatt
actactgatggatttacctctctagctacagcagcaaaggctgattctacactactagtg
gatctacaacagttcaagatttatagtaatccaaataaagcagctgatgaaaggtgctgt
gaaattccaggaatttgtgacgctctaggaattgaaaccgcctcagcagaatgtgactgt
gtggctgctatgtctggtttccccggtttccctggttcaaagggttatgaaggtgaggaa
ggtaccaatggatttcctggacctcagggcagaaagggttaccaaggttttaaaggtgcc
caggggagaaggggtgatcaaggggaaaggggcgaggaaggaatagaaggatctgaaggg
gatcctggttactcaggagccataggactccctggtctccctggagagaatggtgttgct
ggagaacctgggcaaaagggttcagttggacttccaggcccacgaggggaaccaggatcc
aaaggtgaaaatggtgatatcggaatagttggtgaagaaggcagacccggtccctcgggt
gaaaagggctctcgaggcaaaccaggtgcaattggatctcctggtgccatgggaccaaag
ggcttccctggtgagcttggattctcaggagatgcaggagaccacggctatatgggatat
ccaggattaataggacagaggggaccacagggcagaaagggtgctgttggactcagtgga
atctctggtatagatggggagccaggcaaagatggtctactgggagttccaggtttagca
ggtgaaacaggacaaataggagcaaagggaaacagaggggacccagggccaagagggcca
caagggctgcgtggtttgcaaggacctaaaggcaatgcaggggaacctggaataccagga
aagccaggtgctcaaggaataaaaggtttacccggtccacaaggtgaaactggtcccgat
ggtcaaaagggtgagaccggcaaagttggtttagaaggcaaacaagggtctcagggtgac
gaaggtgacataggtgatgaaggccagcaaggacagcgtgggacccctggtttgtttgga
atagatggcagaagaggcgttcctggaatccctggaccacgtggttttcctggttccatg
ggagagtcgggtgaacctgggccagcaggagaaccgggatctgagggctctcagggtcca
ggaatgcctgatgaacaagtatatgagttatgtaaaagtgtgataaatgagcagatagca
atctatgcatcagcaatcagacggacatgtatgacagcttgtccaaccaacaatgtaaca
ctgatgggacctcctggtccttctgggttgccagggaaaccaggagagcaaggtaaacct
ggtcttgatggattggagggtgaacgtggcccaaggggtagaattggatttgctggatca
caaggagctcctggtgctaaaggagatcaaggtgacaagggtgaaaagggagctcaggga
gttggtcttcctggtccagaagggtttcaaggccctagagggtatcctgggtatcctggt
gttgacaaagaaggaaagccaggtccacggggcccagtggggtacactggggctcctggc
cagctaggattgcctggtaatccagggattcctgggatttgtgaagccagagactgtgga
attcatgcagctgcccttcaggctcaacaaggactcttgaaagggccgggttattaa

DBGET integrated database retrieval system