KEGG   Callorhinchus milii (elephant shark): 103185518Help
Entry
103185518         CDS       T03088                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn]-like
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
cmk04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:cmk00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    103185518
Enzymes [BR:cmk01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     103185518
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 103185518
NCBI-ProteinID: NP_001279423
UniProt: K4GBR3
LinkDB All DBs
Position
Un
AA seq 157 aa AA seqDB search
MALLRAVCVMKGSGDVTGSVNFEQTGSGPVTVKGTINGLTPGKHGFHVHVFGDNTNGCVS
AGPHFNPLGKNHGAPQDLERHVGDLGNVEANAAGVANIAIEDKIIQLSGSNSVIGRTLVV
HEKDDDLGKGGHSDSLTTGNAGGRLACGVIGIASAEK
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atggcgcttctgagagccgtgtgcgtgatgaagggcagcggagacgtgaccggcagtgtt
aacttcgagcagaccggaagtggaccggtcacagtaaaaggaactattaatggactgaca
cctggaaaacatgggttccatgttcatgtctttggagacaatactaacggctgcgtcagt
gcaggacctcattttaatcccctggggaaaaaccatggtgcaccacaagatctagagaga
catgtaggtgacctgggcaatgttgaagctaatgcagctggtgtggccaatattgccatt
gaggataaaattatccaactgtcaggcagcaattccgttattggacgcactcttgtggtt
catgagaaggatgatgacctgggaaaaggtggacacagtgacagtcttacaactggaaat
gctggaggacgtttagcttgtggagtgattggaattgcctctgcagaaaagtga

DBGET integrated database retrieval system