KEGG   Callorhinchus milii (elephant shark): 103187713Help
Entry
103187713         CDS       T03088                                 

Gene name
ace
Definition
(RefSeq) angiotensin I converting enzyme
  KO
K01283  
peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
cmk  Callorhinchus milii (elephant shark)
Brite
Enzymes [BR:cmk01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     103187713 (ace)
Peptidases [BR:cmk01002]
 Metallo Peptidases
  Family M2
   103187713 (ace)
Exosome [BR:cmk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103187713 (ace)
CD molecules [BR:cmk04090]
 Proteins
  103187713 (ace)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 1295 aa AA seqDB search
MQVKMPWFLPLLLIVGNACALEDKYKPGNYTKDEAGALLFVADYNTTAESIYFKSVSASW
NYNTNLTKYNQQKQINASLVEQEFTEAWAKKAKELFDDISKNFNDTELKKILREIRILGP
ANLDPQKREKYNTILTEMDNIYSTAKVCPPSQENITKCWSLEPDLVQLLAKSKSYQKLLY
AWEGWHNSAGIPQREKYTEFVDMSNEATRLDGFEDTGEYWRSWYESPTFEEDLEFIYHQL
KPLYLNLHAYVRRKLYQRYGAKYINLRGPIPAHLLGNMWAQQWNNIYEMMIPFPDKDNID
VTDAMVQQNWNATRMFRVAEDFFKSLNLTEMPKEFWDESMLEKPNDGREVVCHASAWDFL
NRKAFRIKQCTTVTMEQLFTVHHEMGHIQYYLQYKDQPVTFRAGANPGFHEAIGDVMSLS
VSTPKHLEKIGLLQTVSDGHEAEINYLLKMALEKIAFLPFGYLIDQWRWGVFSGRISPLH
YNYEWWYLRTKYQGICPPISRNETHFDAGAKYHVPGNTPYIRYFVSCILQFQFHKALCNA
SNHTGALHTCDIYKSTVAGEKLRQALRAGSSRSWEEILKEVTGDGKMDASALLEYFQPVT
TWLEKQNVLNNDVLGWPDFDWRPQVPDGYPNGIEKNTDETEAEDFIKKYNMTAEKVWNDY
TVASWAYNTNITEHNKQVMMDKNLKMANHSVEYGLQARQFDSTNFQNEATKRILNKLSDI
QQAALPEPELIEYNNILSDMETTYSVAKVCRANGTCHPLDPDLTEIMASSSNYSELLFAW
NGWRNVSGKKMRNNFKRYVELSNKAARLNNHADAGAFWRSLYDSETFEADLERIYNQLQP
LYLNLHAYVRRGLYQKYGDKYINLKGPIPAHLLGNMWAQSWNNIYDLLTPYPNVSHVDAT
PAMIAQGWTPKKMFEESDKFFTSLGLIQMPKEFWDKSMLMKPEGREVVCHASAWDFYNRK
DFRIKQCTVVNMEDLVTVHHEMGHVQYFLQYKDQPVSFRDGANPGFHEAIGDVMALSVST
PKHLHTIGLLSEVEDNIEMDINYLLSIALEKIAFIPFGYLMDKWRWKVFDGQISENDYNR
EWWNLRLNYQGLCPPVPRSEQDFDPGAKFHIPSNVPYVRYFVSFIIQFQFHERLCEVANQ
TGSLFKCDIYKSKEAGKLIADVMKLGSSKPWSEAMKLITGKPDMSAEPLLKYFKPLTDWL
IEKNIKNGETLGWPEYNWTPALGSDNLPIPTSTPEEAKDKVDFLGLTLDPQQAKAGQWIL
LSVGIALVFLVLFVVMKFLSNKRSPKKSTSELELK
NT seq 3888 nt NT seq  +upstreamnt  +downstreamnt
atgcaagtcaaaatgccttggtttctgccactgctgcttattgtagggaacgcatgtgcc
ctggaggacaaatacaaacctggcaactacaccaaggatgaagcgggtgctttgttattt
gtggctgattacaacacaacagcagagagcatttatttcaagagtgtttcagccagctgg
aattacaacaccaatctgaccaaatataaccagcagaaacagatcaatgcctcgctagtt
gagcaagagtttacggaagcctgggccaagaaagccaaggaattgtttgacgacataagt
aagaacttcaatgatacagagctgaagaaaatactgagagagattcgaatcctaggccct
gcaaatcttgacccacaaaagagagagaagtacaacaccatcctgactgaaatggataat
atctattccacagcgaaggtgtgtcccccaagccaagagaatatcactaagtgctggtcg
cttgaaccggatctcgtgcaacttttggcaaaatccaaaagctaccagaagctgctgtat
gcctgggaaggctggcacaactccgcaggaatacctcagagagagaagtacacagagttt
gttgacatgagcaatgaagccactcgtttggatgggtttgaggatactggagagtactgg
agatcatggtatgaatcgccaacatttgaggaagatcttgaattcatctaccaccagttg
aaacctctctacctcaacctccatgcttatgtgagaagaaagttatatcaaagatatgga
gccaaatatatcaatctgagaggacctattcctgcacatctcctgggtaatatgtgggca
cagcagtggaataatatctatgaaatgatgatcccattcccagacaaagacaacattgat
gttactgatgcaatggttcagcaaaattggaacgccacccgtatgttcagagttgctgag
gatttcttcaaatcattgaatcttactgagatgcccaaggagttctgggatgaatcaatg
ctggaaaagccaaatgatggccgcgaggtggtgtgccacgcttcagcctgggattttctg
aaccgcaaggctttcagaatcaaacaatgtacaacagtcacaatggagcaactcttcacc
gttcatcacgagatgggtcacatccagtactatctgcagtacaaagaccagcccgtcaca
tttagagctggagccaatccaggtttccatgaagcaattggggatgtaatgtcactctca
gtgtcaacaccaaagcacctggagaagattgggctgctgcaaacagtctcagacggacac
gaggctgaaatcaattatcttctgaagatggctctagaaaaaattgccttccttcccttt
ggctatttgatagaccagtggaggtggggagtgttcagtggacgcatctctccattgcat
tacaactacgaatggtggtacctgaggacaaaataccaaggaatatgcccaccaatttct
aggaatgaaacacattttgatgctggtgccaagtatcacgtcccaggaaacacaccttac
atcagatattttgtgagttgtattctgcaattccagtttcataaagctctgtgcaatgct
tcaaaccatactggagctctacatacatgtgatatctataaatccacggtcgctggtgag
aagctcagacaagcactgagggctggctcttccagatcttgggaggagattcttaaggaa
gtgacaggtgatgggaagatggatgcctctgctctacttgaatattttcagccagtcact
acatggcttgaaaaacagaatgtgttaaataatgacgtgcttgggtggcctgatttcgat
tggcgcccacaagtccctgatgggtatccaaatggcattgagaagaacacggatgaaact
gaggcagaagattttataaagaaatacaacatgacggcggagaaggtgtggaacgattat
acagtggcatcgtgggcctacaacaccaacatcactgagcacaacaaacaggtcatgatg
gacaaaaatctgaaaatggctaatcactcagtggagtacggcctgcaagctcgccagttt
gactccacaaatttccagaatgaagcaactaaacggatcctgaacaagctgagcgacatt
cagcaggcagctcttccagaaccagaattgatagagtataacaatattctatctgacatg
gaaaccacctacagtgttgccaaagtgtgtcgagccaatgggacatgtcaccctctggac
cctgatctgacggaaataatggcatcctcatctaactacagtgaactgctgtttgcctgg
aatgggtggagaaatgtttctgggaagaaaatgaggaacaacttcaagagatacgtggaa
ctcagcaacaaggcggcacgattaaataatcacgcagatgctggagctttctggaggtcg
ctgtatgattctgaaacatttgaggcagatttggagaggatttacaaccagctccagcct
ctatacttgaatctgcatgcttatgtccgacgtggattgtatcagaagtacggagataaa
tacatcaaccttaagggcccaataccagctcacttattaggaaacatgtgggcccagtcg
tggaataatatctatgatctgttaacaccttatcctaacgtctctcatgtcgatgctact
ccagcaatgattgctcagggttggactcccaaaaagatgtttgaagaatcagataagttt
tttacatctctcgggcttatccaaatgccgaaggaattctgggataagtcgatgttgatg
aaacctgaaggcagggaggttgtctgtcatgcttctgcctgggacttttataacaggaaa
gattttaggattaagcaatgtactgtggtcaacatggaagatctggtcactgtccaccat
gaaatgggccacgttcagtacttccttcagtacaaagatcagccggtctcattccgagat
ggagcaaacccaggattccacgaggcaattggcgatgttatggctctttccgtttccact
ccaaaacatctgcacaccatcggcctactcagtgaagtagaggacaatatcgaaatggat
atcaactacctgttgagcattgctctggaaaaaattgctttcattccatttggatatctg
atggataagtggcgatggaaggtttttgatggacagattagtgaaaatgactacaaccga
gagtggtggaacctcaggttaaattatcagggattgtgtcctcctgttcctcgttcagag
caagatttcgatcccggggcaaaattccatattccttcaaacgttccctatgtcaggtat
tttgtgagcttcatcatccagttccagttccatgaacgcctttgtgaagtagcaaaccaa
acaggttccctgtttaagtgtgacatctataagtccaaggaagctggaaaattaattgcg
gatgtcatgaagcttggtagcagcaagccctggtctgaagccatgaagttaataacaggg
aagccagatatgtctgctgagcctctactgaagtacttcaagccactgacagactggctt
attgagaagaacatcaagaatggagagaccctgggatggcctgaatacaattggactcca
gctctaggctcagacaatctgccaattccaacttcaacaccagaagaggcgaaagataag
gtggattttctgggattaacattggatccccagcaggcaaaagcaggacagtggattctg
ctttcagtcggtattgccctagtctttttagttttgtttgtggtaatgaaatttctttca
aacaaaagaagcccaaaaaagtcaacatctgaactcgaactaaaataa

DBGET integrated database retrieval system