KEGG   Callorhinchus milii (elephant shark): 103190749Help
Entry
103190749         CDS       T03088                                 

Gene name
b3galt4
Definition
(RefSeq) beta-1,3-galactosyltransferase 4
  KO
K03766  
beta-1,3-N-acetylglucosaminyltransferase 5 [EC:2.4.1.206]
Organism
cmk  Callorhinchus milii (elephant shark)
Pathway
Glycosphingolipid biosynthesis - lacto and neolacto series
Metabolic pathways
Module
Glycosphingolipid biosynthesis, lacto-series, LacCer => Lc4Cer
Glycosphingolipid biosynthesis, neolacto-series, LacCer => nLc4Cer
Brite
KEGG Orthology (KO) [BR:cmk00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    103190749 (b3galt4)
Enzymes [BR:cmk01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.206  lactosylceramide 1,3-N-acetyl-beta-D-glucosaminyltransferase
     103190749 (b3galt4)
Glycosyltransferases [BR:cmk01003]
 Glycan extension
  Type 2 chain/Poly-N-acetyllactosamine
   103190749 (b3galt4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 365 aa AA seqDB search
MEMLRRFNKCRLIGFLRKPRLGVGLLLVLMLTGIPFLVDYAQEWTLRRDPTPITNGSIVQ
MRARAVSFNMEVFRHNASKYYLIPNTNACDGPDVFLVSFVISKTGHFQSREAIRQSWASV
KDVQGHTVLILFALGVPESTEEQERIEEESSQYKDVVQGVFRDTYHNLTLKTIMIMQWFG
TYCPAARYLLKVDDDVFLNYHNLMEHLIGLSDDSEDLYLGWVHRRVRPVRNKNDLYYVSE
SVYSKDVYPDYCSGTSYVVSKDVVLKVYVAALTTPLITIEDVFVGLCAHKMGVSPTHTSK
ISGPVRFHLNQCCYKSIYASHHIKPGEFLKIWKLVNDGSRCSLLAKYTGLFMCKALALLS
PVINQ
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atggagatgctacgtcgcttcaataaatgccggctgattggctttctgcggaaacctcgg
ttgggtgtgggtttgttgctcgtgttgatgctcacgggcattcctttcctggtggattac
gcccaggaatggaccctgcggagagacccaacgcccatcaccaatggcagtatcgtgcag
atgcgggcgagggccgtgagcttcaacatggaggtcttcagacacaacgcttccaaatat
tacctcattcccaacacaaacgcctgtgacggtcccgacgtcttcctggtcagctttgtc
atcagtaaaacgggccacttccaaagccgggaggccatccgccagagctgggcgagcgtc
aaggacgttcaaggacacacagtgttaatactcttcgctttgggggtccccgagagcaca
gaagaacaggagagaatcgaggaagaatcatctcaatacaaggacgtggttcaaggggtc
tttagggatacttaccacaacctgaccctgaagaccatcatgataatgcaatggttcggc
acttattgcccggctgccagatacctcctcaaagtcgacgacgatgtctttctgaactat
cacaacctaatggagcatctcataggcctcagcgacgattccgaggacctgtatctgggt
tgggtccatcgtagggtcagacccgttcgaaacaagaacgatctgtactacgtctcggag
tccgtgtactcgaaggacgtctacccggactactgcagtgggacgtcttatgttgtgtcc
aaggatgttgtcctcaaggtctacgtggcagcattgaccactccgctgataaccatcgaa
gatgtctttgtggggttgtgtgctcataagatgggggtttcacccactcacacctctaag
atatctgggccagttcgatttcacttaaaccaatgttgctacaagtctatatacgcttcc
catcacatcaagccgggagagttcctgaagatatggaagcttgtgaatgacgggagcaga
tgctcgttgctcgctaagtacactgggctgttcatgtgcaaagccctcgccttgttgagt
ccagttattaatcaatga

DBGET integrated database retrieval system