KEGG   Cucumis melo (muskmelon): 103492841Help
Entry
103492841         CDS       T03195                                 

Definition
(RefSeq) glutathione S-transferase PARB-like
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
cmo  Cucumis melo (muskmelon)
Pathway
Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:cmo00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    103492841
Enzymes [BR:cmo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     103492841
Transporters [BR:cmo02000]
 Other Transporters
  Pores ion channels [TC:1]
   103492841
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Un
AA seq 216 aa AA seqDB search
MASIKVHGSPISTATSRVLACLYEKDLDYEFVLLDMKNNEHKKHPFLSINPFGQVPGFQD
GDLTIFESRAITQYLATAYANKGTQLIPNDPKKAAIVSTWIEVEGHHYDPPGVALSFEHL
VKPLFGLGETDPAAVAENEAKLGKVLDIYENQLSKNKFLAGDEFSLADLHHIPNISYLLA
TPSKKLFESRPRVNAWVTDILARPSWAKVTALRNQS
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggccagtatcaaagtccatggaagcccaatttccactgccacgtccagagttctcgct
tgtctttacgagaaagatctcgattatgagttcgttcttctggatatgaaaaacaacgag
cataagaaacacccctttctctccattaatccgtttggtcaagttcctgggtttcaagat
ggggatctcaccattttcgaatcaagggccattactcaatacttggccacggcctacgcc
aacaagggaacccagttgatccccaacgacccaaagaaagcggcgatcgtatcaacgtgg
atcgaagtggagggccaccattacgacccacctggggtggctttgtcgttcgagcatcta
gtcaagccattatttggcctcggcgaaaccgatcccgcagcggtggcagagaatgaagcc
aagctggggaaagttcttgacatctacgagaatcagcttagcaaaaataagttcttagca
ggggatgaattcagtttggcggatttgcaccacatccccaatatcagctacttgttggca
acaccgtcgaagaagctgttcgagtcacggccgcgtgtcaacgcttgggtgactgatatc
cttgcaaggccttcgtgggctaaggtaacagccttgcgcaatcagagttaa

DBGET integrated database retrieval system