KEGG   Cucumis melo (muskmelon): 103494160Help
Entry
103494160         CDS       T03195                                 

Definition
(RefSeq) probable glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cmo  Cucumis melo (muskmelon)
Pathway
cmo00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:cmo00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    103494160
Enzymes [BR:cmo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     103494160
Transporters [BR:cmo02000]
 Other Transporters
  Pores ion channels [TC:1]
   103494160
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C_2 GST_C GST_C_3
Motif
Other DBs
NCBI-GeneID: 103494160
NCBI-ProteinID: XP_008453455
UniProt: A0A1S3BVQ6
LinkDB All DBs
Position
Un
AA seq 224 aa AA seqDB search
MAEVKIIGSAASLFSVRVEWALKLKGIEYEYIVEDLRNKSELLLKSNPVYKKIPVLLHND
KAISESLLIIEYIDETWKENPILPEDPYDRANARFWAKFLDEKGLLGAWEACQAEGEEKE
KAVEAAVQHLALLDKEIQGKKFFGGEKIGYLDLAAGWICHWLSVLDEVGEMNVFDRERFP
SLHEWAQNFIHVPVIKESLPPREILVNYFKGSLSYVRSLAANKK
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggcagaggtaaagattattggatcagctgcaagcctattctccgtaagggtcgaatgg
gccttgaagctcaaaggaattgagtatgagtacatagttgaagacttgagaaacaaaagt
gagctacttctcaagtccaaccctgtatacaagaaaatacctgtgcttttgcacaatgac
aaagccatctccgagtcgcttctcattattgaatacatcgacgagacgtggaaggagaac
ccgatattgcctgaagatccatatgacagagccaatgctcgcttctgggctaagttttta
gacgagaagggtttgctcggtgcctgggaagcttgccaggctgaaggagaagagaaagag
aaggctgtagaggctgcggtacaacatttggcactgcttgacaaagaaatacaaggaaag
aaattctttggtggagagaaaattggttacctagatttagctgcaggttggatttgccac
tggctcagtgttctggatgaagtgggagaaatgaatgtgtttgacagagaaaggttccca
tcccttcatgaatgggctcaaaacttcatccacgttccagttatcaaagaatcgcttcca
cccagagaaattcttgtcaactacttcaaggggagtctgagctacgtccggtccttagct
gcaaataagaaataa

DBGET integrated database retrieval system