KEGG   Cucumis melo (muskmelon): 103498127Help
Entry
103498127         CDS       T03195                                 

Definition
(RefSeq) hexokinase-1
  KO
K00844  
hexokinase [EC:2.7.1.1]
Organism
cmo  Cucumis melo (muskmelon)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cmo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103498127
   00051 Fructose and mannose metabolism
    103498127
   00052 Galactose metabolism
    103498127
   00500 Starch and sucrose metabolism
    103498127
   00520 Amino sugar and nucleotide sugar metabolism
    103498127
  Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    103498127
Enzymes [BR:cmo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     103498127
Membrane trafficking [BR:cmo04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    103498127
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Un
AA seq 583 aa AA seqDB search
MERKVSMPRNDREIMAPSSQIKRRKIDHHPSRRSLSSAAIERHRVSASTKGSTFPVASGS
EFRILQDKSSAIAEAKQDGCTGNFKMGKVAVGAAVVCAAAVCAAAALVVRHRMRNSGKWA
RAMAILREFEEKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISYVDNLPTGDEKG
LFYALDLGGTNFRVLRVQLGGKENRVVKQEFEEVSIPPHLMVGSSEALFDFIAQALAKFV
AEEGEGFHPAPGRQRELGFTFSFPVRQTSISSGTLIKWTKGFSIEDTVGEDVVGELTKAM
EKLKLDMRVTALVNDTIGTLAGGRYHDNDVIAAVILGTGTNAAYVERAHAIPKWHGLLPK
SGEMVINMEWGNFRSSHLSLTEYDHALDAESLNPGEQIFEKLISGMYLGEIVRKVLVKMA
EEATIFGETVPPKLKIPFILRTPHMSAMHHDTSPDLKVVANKLKDVLEISNTSLKTRKII
VELCDVVATRGARLSAAGILGILKKLGRDTIRVGEKQKSVVALDGGLYEHYTKFRTTMEN
TLKELLGDEVAANVFVEHSNDGSGIGAALLAASHSQYLEVDEP
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atggaacggaaagtttcgatgccgcgaaacgaccgggaaattatggcgccttcatctcag
atcaagcggcgaaaaatcgatcatcatccgtcgcgccgatctttatcttcagctgctata
gagagacatcgagtttcagcatcaactaaaggctcaacttttcctgttgccagtgggagt
gaatttcggatactacaggataagagttctgccatagcagaggccaaacaagatggttgc
actggtaattttaagatgggcaaggttgcggtgggagcggcggtggtgtgtgcggctgcg
gtttgtgctgcagcggcgctagtggtgcggcaccgaatgagaaactccgggaagtgggcg
cgagcaatggccattttgagagagttcgaggaaaaatgtggaaccccaattggaaaactc
aggcaggtggccgacgccatgaccgtcgagatgcacgccggtcttgcatccgaaggcggt
agcaagctcaagatgctgatcagctacgtcgataatctcccgaccggagatgaaaaaggg
ctcttctatgcattggatctcggcggtacaaattttcgagtgttgcgtgtgcagttggga
gggaaggagaaccgggttgtcaagcaagaatttgaggaggtttcaatacctccacacttg
atggttgggtcttcagaagctctatttgattttatagctcaagcacttgcgaagtttgtt
gctgaagaaggtgaaggctttcacccagcaccgggtaggcaaagggaattgggttttacc
ttctccttccctgttaggcaaacatcaatatcatcagggacacttattaaatggacgaaa
ggcttcagcattgaagacacggttggggaagatgtggtcggtgaattaaccaaagccatg
gaaaaactgaaactcgacatgcgtgtaacagcgttggtaaatgacacgattggaacatta
gcaggaggtagataccatgataacgatgtaattgctgctgtgatattaggcaccggaaca
aatgcagcttatgtagagcgtgcccatgcaattcccaagtggcacggtctacttcctaaa
tcaggagaaatggtaattaacatggaatggggtaacttccggtcctctcatctgtcactt
acagaatatgatcatgcattggatgctgagagtttaaaccctggagaacagattttcgag
aagttgatttctggtatgtacttgggagaaattgtacgtaaagtattggtcaagatggct
gaagaagcgactatctttggcgaaactgttccacccaaactgaaaattccatttatattg
aggactcctcacatgtctgccatgcatcacgacacgtcgcccgatctcaaagttgttgca
aacaaactgaaggatgtcttggagatatctaatacctccttgaaaacaagaaaaatcata
gtggagctctgtgacgtagtcgcaacacgaggcgcccgtctctctgctgctggtatctta
ggcatcctgaaaaaactgggaagagacaccatccgggttggggagaagcagaagtctgtt
gtagcattggatggagggttgtatgagcactacacaaaattcagaacaaccatggaaaat
acactgaaggagctactcggagatgaggttgctgcaaacgtcttcgtcgagcattcaaat
gatggttctggtatcggagctgcactacttgcagcctctcactctcaatatctcgaggtc
gatgagccctaa

DBGET integrated database retrieval system