KEGG   Cucurbita moschata (crookneck pumpkin): 111448471Help
Entry
111448471         CDS       T05248                                 

Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
cmos  Cucurbita moschata (crookneck pumpkin)
Pathway
cmos03030  DNA replication
cmos03410  Base excision repair
cmos03420  Nucleotide excision repair
cmos03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:cmos00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    111448471
   03410 Base excision repair
    111448471
   03420 Nucleotide excision repair
    111448471
   03430 Mismatch repair
    111448471
Enzymes [BR:cmos01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     111448471
    6.5.1.6  DNA ligase (ATP or NAD+)
     111448471
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     111448471
DNA replication proteins [BR:cmos03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    111448471
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     111448471
DNA repair and recombination proteins [BR:cmos03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     111448471
   NER (nucleotide excision repair)
    Other NER factors
     111448471
   MMR (mismatch exicision repair)
    Other MMR factors
     111448471
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 111448471
NCBI-ProteinID: XP_022943872
LinkDB All DBs
Position
Unknown
AA seq 804 aa AA seqDB search
MLSLRSCYCLRPITLPHPQFKKLIFSNKPPPFKPIFQNFVSAMSSRPSAFDALMSGARAA
AKKKPVNSSPKKRKALDSLGPPPKPNSSLALESTPPVESQCGSSTSTLDNHGDPNPVKSE
EAVDLGETKLRQDDGGNFGGKIGPVANKKCASSVQERTAKLKSSIPELKKKAKDFNSKTF
ACWNEGERVPFLFLCLGFDMISEESSRITITDIVCNMLRTVMDTTPDDLVATVYLLANKI
APAHEGLELGIGDASIIKALSEAFGRTEAQVKKQYKELGDLGLVAKASRSSQSMMRKPDA
LTITKVFDSFRLIAKESGKDSQEKKKNHIKSLLVAATDCEPLYLIRLLQTKLRIGLAEQT
LLAALGQAAVYAEKHSTPPANVQSPLEEGAKIVKQVYSVLPVYDKLVPALLNGGVWNLSK
TCNFTPGIPIGPMLAKPTKGVSEILNKFQGLEFTCEYKYDGERAQIHYMEDGSVEIYSRN
AERNTGKFPDVVLTVSRIKKPSVRSFILDCELVAYDRGKQKILPFQILSTRARKNVAVSD
IKVEVCVFAFDLLYLDGQPLIHKELSVRREHLYDSFIEEAGYFQFATAITTSDLEEIQKF
LDASVDQSCEGLIIKTLNRDATYEPSKRSLNWLKLKKDYIDNIGDSLDLVPIAAFHGRGK
RTGVYGAFLLACYDNDNEEFQSICKIGTGFSEAMLEERSASLRSKVIPEPKSYYRYGDTI
NPDVWFEPTEVWEVKAADLTISPVHRAGVGIVDSNKGISLRFPRLVRVRKDKTPEEATLS
EQVADMYNAQKLNHQNNQDDNDED
NT seq 2415 nt NT seq  +upstreamnt  +downstreamnt
atgctttctctgcgttcatgctactgtttacgccccattacattgcctcatccccaattc
aagaaactcatcttctccaacaaacctccccctttcaaacccatttttcagaattttgtt
tcagcaatgtcttctcgtccttctgctttcgatgctctcatgtccggtgctcgggccgct
gccaagaagaagcctgtaaattcttctcccaagaagcgtaaagccctagattctttaggc
cctcctccgaaacctaactcttccctggctttggagtcaacgccgcctgttgaatcgcag
tgcggtagttcaacctcaactttggataatcatggagatcctaatccggttaagtccgag
gaagctgtagatttgggggaaaccaagttgcgtcaggatgatggtgggaattttggaggc
aagattgggccggttgcgaataagaagtgcgcgtctagtgttcaagaaagaactgcgaaa
ttgaagagctctatcccagagttgaaaaagaaggccaaggatttcaactcgaaaacattt
gcatgttggaatgagggcgaacgggttccatttttgtttctgtgtttggggtttgatatg
atttcggaggagtctagtaggattactatcaccgatatcgtctgcaacatgttgaggacc
gtcatggatactacacccgacgacttggtagccactgtgtatcttttggcgaataagatt
gctcccgcgcacgaagggctcgagttgggtattggggatgcttctattatcaaagctctt
tctgaggcatttgggaggacagaggcacaggttaaaaaacagtacaaggaattgggagat
ttaggtcttgttgccaaagcgagccgttcgtcacaatccatgatgcgaaagcctgatgct
ttaactattaccaaagtatttgactcatttcggctgatcgctaaggaatctggcaaggat
agtcaggagaagaaaaagaaccatatcaagtcactgcttgttgctgccactgactgcgaa
cctttgtatctgattagattgctgcagacaaaattgcgaattggacttgctgagcagact
cttttagctgcattagggcaagcagctgtatatgctgaaaaacattcaacacccccagcg
aacgttcaatctcctctagaagagggtgctaagattgtaaagcaggtgtattctgtgctc
cctgtttatgataaacttgtccctgcgcttcttaatggtggtgtgtggaacctttcaaaa
acatgcaactttacaccgggaattccaattggacctatgttggcaaaaccaacaaaggga
gtctccgagatcttaaataaattccagggtttggaatttacttgtgaatacaaatatgat
ggggaacgtgcccagattcattacatggaagatggttcagttgagatctacagtcgaaat
gctgaacggaacactggaaagttccctgatgttgttctcacggtatcaaggataaagaaa
ccatctgtaagatcgtttattttggattgtgaacttgttgcttatgatcgtggaaaacag
aagattttgccttttcagattctgagtacacgagctcgcaagaacgtggccgtgagcgat
attaaggttgaagtgtgtgtatttgcttttgatttactgtatctcgatggtcaaccactt
attcataaagaacttagcgttcgtcgagagcatctctatgattcatttattgaagaagct
ggatattttcaatttgccacagcaataacaacaagcgatcttgaggaaatacaaaaattc
cttgatgcatctgttgatcaaagttgtgagggtttaatcatcaaaacattgaaccgggat
gctacttacgagccttccaagaggtcacttaactggctaaaactgaagaaggattacata
gacaacataggggattcacttgatctggtaccaattgctgctttccatggccgtgggaag
cgtacaggtgtctatggcgcatttctccttgcctgttatgacaatgacaatgaagaattt
caaagcatttgtaagattggaactggtttttctgaagcaatgcttgaggaacgttctgct
agtctccgttctaaagtcattccagaaccaaagtcatattatcggtatggagatacaatc
aatccagatgtttggtttgaacctactgaggtttgggaggttaaagcggcagacttgact
atcagcccagttcatcgtgcaggagtcggcatcgtggattccaacaagggaatttctctt
cggtttccacgtcttgttcgtgtaaggaaagacaaaactccagaggaggccacattgtct
gagcaggttgccgacatgtataatgctcagaaactcaaccaccaaaacaatcaagatgac
aatgatgaagactga

DBGET integrated database retrieval system