KEGG   Chamaesiphon minutus: Cha6605_5443Help
Entry
Cha6605_5443      CDS       T02414                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  
phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cmp  Chamaesiphon minutus
Pathway
Pyruvate metabolism
Methane metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cmp00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Cha6605_5443
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Cha6605_5443
   00680 Methane metabolism
    Cha6605_5443
Enzymes [BR:cmp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Cha6605_5443
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
complement(5753564..5756590)
Genome map
AA seq 1008 aa AA seqDB search
MQPLTHMLEPELMVSTPSNLLLNHRLKVIEDLWERVLRDACGQELVNLLNQLREMCSSDG
SAAEPLPQAVHVLIEKLDLKDAIRAARAFALYFQLINIVEQHYEQCEQKLALKLSLQYSV
PIHAAPQTDRASEHVAPLGAGLLEKTWQASSVEQQKDRGTFAALFPLLKAAGVPPQQVQR
LFDELDIGLVFTAHPTEIVRHTIRDKQRRVAQILEKLDRAEEDMTRLGIQSSWEVAELEG
QLLEEILLWWRTDELHQFKPTVLDEVDYTLHYFEEVLFDAIPQLSQRLNLALKQSFPYLT
PPSNRFCRFGSWVGSDRDGNPSVTPKVTWQTACYQRGIVLKKYIKCTRALTNALSLSLHW
SNVLPELLESLEQDKSHFPEIYEDWAIRYRQEPYRLKLTYIIKRLSNTLDRSRQVSDWDS
LQFPKADLNPNTCYHSGADFLKELRLIRQSLQQTGLTCQALETLICQVEIYGFNLAQLDI
RQESGRHADTIAEITEYLQVFPKSYHDLSETERVEWLVGELKTRRPLIPGELPFSPKAVE
TIETFRMLRRLHQEFGPEICQTYVISMNRDVSDILEVMLLGKESGLYDPATGITSLQVVP
LFETVEDLKKAPLVMQSLFELPLYRAALTGGYQPTPANAIPGLVPHLQEVMLGYSDSNKD
AGFLSSNWEIHKAQKALQAIAEKFNVKLRIFHGRGGSVGRGGGPSHEAILAQPGQSINGR
IKITEQGEVLASKYSLPELALYNLEQVASAVIKTSLMSGGVDDIEPWNEVMEDLADRSRR
HYRALVYDRPELVNFFHQVTPIDEISHLQISSRPARRGGKRDLASLRAIPWVFSWTQSRF
LLPSWYGVGTALEEFVAECPQENFELLQGFYRKWPFFRMAISKVEMTISKVDLQIARHYM
EELSQPEDREQFEILFERIAHEYRLVSDLVLRISGHERFLDDNPELQRSIQLRNGSIVPL
GFLQVSLLKRLRQHGGAGMIYSRYSKRELLDGALLTINGIAAGMRNTG
NT seq 3027 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccgctaacccacatgttagaaccagaattgatggtttcaactccatccaatctc
ttactaaatcatcgactcaaggtaatcgaagacctgtgggagcgcgtgctgcgagatgct
tgcgggcaagaattagtcaatctgctcaatcagttgcgggagatgtgttcctccgatggc
agtgctgccgaacctttaccacaagcggtacacgtcctgatcgaaaaactcgatctcaaa
gatgccattcgtgctgctagagccttcgcgctttattttcaattaattaatattgtcgag
caacactacgagcagtgcgaacaaaaactagctctaaagttgtcgctccagtattcggtg
ccgattcatgcggccccacaaaccgatcgcgcgtccgaacatgttgcccctctaggtgcg
ggtttgctcgaaaaaacttggcaggcttcttctgtagagcagcaaaaagatcgcggtacc
tttgcggctttatttcctttgctcaaagccgccggagtgccaccccaacaggtgcagcga
ttgttcgatgagttggatatcggtttagtctttaccgcccatccgaccgaaattgtgcgg
cataccattcgcgataagcaacgacgggtagcgcagattttggaaaaactcgatcgtgcg
gaagaggatatgacacggttgggaattcaatcttcttgggaagtcgccgaactagaagga
caattactcgaagagattttattatggtggcggacggatgaattacaccaattcaagccg
acagttttggatgaagtagactataccctccattactttgaagaagtattattcgatgcg
attccgcagttgtcacaacgcttgaatttggctctcaagcagtcttttccctatctgacg
ccgccgagcaatcgcttttgtcggtttggttcgtgggttggctccgatcgcgatgggaat
ccgtcggttactcccaaagttacttggcaaactgcgtgctatcagcggggaatcgtcctt
aaaaaatacatcaaatgtacgcgtgcattaaccaatgccctgagtctatccctacattgg
agcaacgttttacctgagttattagagtccctagaacaggacaaatcccattttcccgaa
atctatgaagattgggcaatccgctatcgtcaagagccgtatcgactcaaattaacttat
attatcaagcggctctcgaacacgctcgatcgatctcgtcaagtctcggactgggatagt
ttacagtttcccaaggccgacctcaaccccaatacctgctatcactcaggtgccgacttt
cttaaggaattaaggctgatccgccaaagtttgcagcaaaccgggttgacttgtcaagcc
ttggagacattaatttgtcaggtcgaaatctacggctttaatctggcccaactcgatatc
cgtcaagaaagcggtcgtcatgctgacacgatcgccgaaattaccgaatacctccaagtc
tttcccaagtcttaccacgatctctcggaaaccgaacgggttgaatggttagttggcgaa
ctcaaaactcggcgtccgttaattcctggcgaactcccattttcgcccaaagctgtcgag
acgatcgaaaccttccggatgttacgccgcctccatcaagaatttggccccgaaatctgc
cagacatatgtaattagtatgaaccgagatgtcagtgacattctcgaagtaatgctcctg
ggcaaagaatccggcttgtatgaccccgcgacggggattaccagtctccaagtggtaccg
ctatttgaaaccgtcgaagaccttaaaaaagctccgctcgtcatgcaatctctatttgaa
ttgcccctgtaccgtgcggctctgactggcggctatcagcccacacccgcaaatgccatc
cctggcttggtgccacatctccaagaggtaatgctgggctactccgatagtaataaggat
gcaggcttcctcagcagtaactgggaaattcacaaagcccaaaaagccctccaagcaatc
gccgaaaaattcaacgtcaagctgcggatttttcacgggcgcggcggcagcgtcggtcgc
ggcggcgggccatctcacgaggcgattttggctcagccaggacagagtatcaacggtcga
atcaagattaccgaacaaggcgaagttttggcatccaaatattctttgccagagctagct
ttatacaacttagagcaagtagctagtgcggtgatcaaaaccagtctgatgtctggcggt
gtcgatgatatcgaaccatggaatgaggtaatggaagatctcgcagatcgatcgcgccgt
cactatcgcgcgctcgtttacgatcgaccagagctggttaatttctttcatcaggtcacc
ccgatcgatgaaatcagccatctccaaattagttcgcgcccagctcggcgcggcggtaaa
cgcgatctcgcaagtctccgggcgattccgtgggtatttagctggacgcaaagtcgtttc
ctgctgccttcctggtatggtgtcggtaccgcactagaggaatttgttgccgaatgtccc
caagaaaacttcgagttgctccaaggcttttatcgtaaatggccatttttccggatggca
atttccaaagtagagatgactatttctaaagtcgatctgcaaatcgcgcgccactacatg
gaagaactctcgcaaccagaagatcgcgagcaatttgaaatcctattcgagcggatcgct
catgaatatcgactcgtcagcgatctcgtactgcggatttccggacacgaacgctttcta
gatgacaatcccgagctgcaacgttctattcagctacggaatggtagcatcgttccgtta
ggatttctacaagtctcactactcaaacgtctgcgccaacacggcggtgcagggatgatt
tattctcgctacagcaagcgagaactcctcgatggggcattgctaaccatcaacggcatt
gccgctggaatgcgaaatacaggctag

DBGET integrated database retrieval system