KEGG   Cyclobacterium marinum: Cycma_1733Help
Entry
Cycma_1733        CDS       T01592                                 

Definition
(GenBank) Manganese/iron superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cmr  Cyclobacterium marinum
Brite
Enzymes [BR:cmr01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Cycma_1733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AEL25487
UniProt: G0IUU5
LinkDB All DBs
Position
2023301..2023906
Genome map
AA seq 201 aa AA seqDB search
MAFELPSLPYETNALEPNIDAKTMEIHHGKHHNAYVTKLNDAIKGTDLESKSIEELMENV
SSAPAGVRNNGGGHYNHSLFWTILSPNGGGAPSGDLAAAIDAKFGSFDKFKEEFANAAAT
RFGSGWAWLSVSNGELVVSSTPNQDNPVMDIAETKGTPILGLDVWEHAYYLNYQNRRPDY
ISAFWNVVNWDEVAKRYAAAK
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgaacttcccagcttaccttacgaaacaaatgcattagaaccgaatattgat
gccaaaaccatggaaattcaccatggcaaacatcataacgcttatgtaaccaaattaaat
gatgcgatcaaaggcactgaccttgaatctaaaagcatagaagagctgatggaaaatgtt
tcttctgctcctgcaggagtaagaaacaatggcggtggacactataaccactctcttttc
tggaccatcctttctcctaatggaggtggtgcaccttctggtgacttggccgctgcaatt
gatgcaaaatttggttcttttgataaatttaaagaagaatttgctaacgctgccgctacc
agatttggatcaggttgggcttggttaagtgtgagtaacggtgaattggtcgttagttct
actcctaaccaagacaatccggttatggatattgcggaaaccaaaggaactccaattctt
ggattagatgtttgggaacacgcgtattacctaaactaccaaaacagaagacctgattat
atttcagcattttggaatgttgttaattgggatgaggtagccaaaagatatgctgcagcc
aaataa

DBGET integrated database retrieval system