KEGG   Cordyceps militaris: CCM_00746Help
Entry
CCM_00746         CDS       T03108                                 

Definition
(RefSeq) histone-lysine N-methyltransferase
  KO
K11419  
histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
cmt  Cordyceps militaris
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:cmt00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    CCM_00746
Enzymes [BR:cmt01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     CCM_00746
Chromosome [BR:cmt03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     CCM_00746
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    CCM_00746
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 316 aa AA seqDB search
MEQATKEHFYNHGKTASPGCHWCQVRALGLTIVNEVDREFLPANFEFINGMVLGKGVEPA
EDSFRSGCSCADDGNCQYTSCPCLADLEDDDMDVNDGTRKAYAYHTHGAKAGFLRSRLLD
STVPLYECHKGCACSSQCPNRVVERGRTVPLQIFKTANRGWGVRSQAPIKRGQFVDRYLG
EIITAKEADRRRANSSVSQQKDVYLFALDKFTDPHSLDPRLNSSPLEVDGEFMSGPTRFI
NHSCDPNLRIFARVGDHADKHIHDLALFAIKDIQRGEELTFDYVNGVDEEQDEMDGNVEG
MTKCLCGSAICRKFLW
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggagcaggccacgaaggagcacttttataaccatggaaagacagccagcccaggctgt
cactggtgccaagtgcgcgcgcttgggctcaccattgtgaacgaggtggatagagaattt
ctgcctgcaaattttgaattcatcaatggcatggttcttgggaaaggggttgagcccgca
gaggatagtttccgcagcggctgctcttgtgcagatgatggcaattgccaatacaccagc
tgtccctgcctagccgatctggaagacgacgacatggacgtgaacgatggcaccagaaaa
gcatacgcataccatacacacggcgcaaaggcggggtttctacgatccaggctgctagac
tcgactgtgcctctgtacgaatgccacaaaggctgtgcttgttccagtcaatgcccaaac
agagttgtcgagcgtggccgcaccgtgccactacaaatattcaaaacggccaaccgtgga
tggggagttcgctcacaagcccccatcaaacgaggccagtttgttgatcgctaccttggc
gagatcatcactgcaaaggaggccgaccgccgccgcgcaaactcttcagtatcccaacaa
aaagacgtctatcttttcgcacttgacaagttcaccgatccgcattcactggatccacga
ctcaacagctctccactggaggtggacggtgagttcatgtccgggccgacccgcttcatc
aaccactcttgtgatcccaaccttcgcatatttgcccgcgtcggtgaccatgcagacaaa
catattcacgatcttgctctgtttgccatcaaagacatacaacgcggagaggagctcacc
tttgattatgtcaacggcgtcgatgaggaacaagatgagatggacggtaatgtggagggc
atgacgaaatgcctttgtggaagtgcaatctgcagaaagtttctttggtaa

DBGET integrated database retrieval system