KEGG   Cordyceps militaris: CCM_06124Help
Entry
CCM_06124         CDS       T03108                                 

Definition
(RefSeq) Pyridoxal phosphate-dependent decarboxylase
  KO
K01580  
glutamate decarboxylase [EC:4.1.1.15]
Organism
cmt  Cordyceps militaris
Pathway
Alanine, aspartate and glutamate metabolism
beta-Alanine metabolism
Taurine and hypotaurine metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:cmt00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    CCM_06124
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CCM_06124
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CCM_06124
   00430 Taurine and hypotaurine metabolism
    CCM_06124
Enzymes [BR:cmt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     CCM_06124
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
LinkDB All DBs
Position
Unknown
AA seq 518 aa AA seqDB search
MTPPAATAAAAQNGNAAPATVPGPLLNRAGELEHLLQAVQDLIIPFVKAADDAAAEKPTG
AIPKGRPNVLVQTTAPAELAAKLDLVLPAEGQGTDGLLVMIQRILDYSVNTWDQGFLDKL
YASNTPVGVISDIILSILNTNLHVYQVSPALSVIEKATGRALAGLFGFTGDFAGGITCQG
GSSSNLTSLVVARNTLYPESKSKGVAGAGHDFVVFTSAHGHYSVEKSAMICGLGGDSVWA
VPIDDAGCMRADALRELVVHAQAQGKTPLYVNATAGTTVRGSYEPFAEIAAICKEFGLWM
HIDASWGGPVVFSRAHRHKVAGSHLADSITINPHKMMNVPTTCSYLLIPDTRTFKVANST
KAGYLFHDGAGGDAETWDLADLTLQCGRRGDSLKLALAWLYYGADGFERQIDHAFAMAAL
LHTRLERTGNFALLSENPTPCLQVCFYYAPAGVLSADKQANTAHTQRIVHALIERGFMVD
YAPGDSGSFLRVVVNVQTLPGTVDGLAKALNEVGAEGQ
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgacaccacccgcagcgaccgccgccgccgcccaaaatggcaatgccgcgccggcgacc
gtccccggcccgttgctgaaccgggccggtgagctggagcatctcctccaagctgtccag
gacctcatcattccctttgtcaaggccgccgacgacgccgccgccgaaaagcccaccggc
gctatacccaagggccggcccaacgtcctcgtccagacgaccgcgcctgccgagctcgcc
gccaagctcgacctcgtcctgcccgcagagggccagggcaccgacggcctgctcgtcatg
atccagcgcatcctcgactacagcgtcaacacctgggaccagggcttcctcgacaagctc
tacgccagcaacacgccggttggcgtcatttccgacataattctctccatcctcaacaca
aatctccacgtctatcaagtctcgcccgcgctctccgtcattgaaaaggccaccggccgc
gccctcgccgggctgtttggcttcaccggcgactttgccggcggcatcacgtgccagggc
ggcagctcgagcaacctgacctcgctcgtggtggcgcgcaacacgctgtaccccgagtcc
aagtccaagggcgtggcgggcgcgggccacgactttgtcgtcttcaccagcgcgcacggg
cactactcggtcgagaagagcgccatgatctgcgggctcggcggcgacagcgtgtgggcc
gtgcccattgacgacgccggctgcatgcgcgccgacgccctgcgcgagctcgtcgtgcac
gcccaggcccagggcaagacgccgctctacgtcaacgccacggcgggcaccacggtgcgc
ggctcgtacgagccctttgccgagatcgccgccatctgcaaggaattcggcctctggatg
cacattgacgccagctggggcgggcccgtcgtcttctcgcgcgcccaccgccacaaggtc
gccgggtcgcacctcgccgactccatcaccatcaacccgcacaagatgatgaacgtgccg
acgacgtgctcgtacctgctcatcccggacacgcgcaccttcaaggtcgccaacagcacc
aaggccggctacctgttccacgacggcgccggtggcgacgccgagacgtgggacctggcc
gacctcaccctgcagtgcggccgccgcggcgacagcctcaagctcgccctcgcatggctc
tactacggcgccgacggcttcgagcgccagattgaccacgcctttgccatggccgcgctg
ctgcacacgcgcctggagaggacgggtaactttgccctgctgtctgagaacccgaccccg
tgcctgcaggtctgcttctactacgccccggctggcgtgctgtctgcggacaagcaggcc
aatacggcgcatacgcagcgcatcgtgcacgcgctgattgagcgcggcttcatggtggat
tatgcgcccggcgacagcggcagttttctgcgcgtcgtcgtcaatgtgcagacgctgccc
ggcactgtcgacggcctggccaaggcgctcaacgaagtaggcgcagagggccaatga

DBGET integrated database retrieval system