KEGG   Chlamydia muridarum Nigg: TC_0567Help
Entry
TC_0567           CDS       T00028                                 

Gene name
sod
Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
cmu  Chlamydia muridarum Nigg
Brite
Enzymes [BR:cmu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     TC_0567 (sod)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N Imm3
Motif
Other DBs
NCBI-ProteinID: AAF39404
UniProt: Q9PKA0
LinkDB All DBs
Position
complement(677490..678113)
Genome map
AA seq 207 aa AA seqDB search
MAMVFSSYKLPDLPYDYDALEPVISAEIMHLHHQKHHQGYINNLNEALKSLDVASATQDL
TGLIAINPALRFNGGGHINHSLFWEMLAPQNKGGGTPPRHELLKLIEKFWGSFDNFLKNF
ISSSAAVQGSGWGWLAFCPKKQELMIQTTANQDPLEATTGMIPLLGVDVWEHAYYLQYKN
ARLDYLKNFPSIINWDYIESRFVEMSK
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atggctatggttttttcttcttataagcttcccgatttaccttatgattacgatgctttg
gaacctgtaattagcgcggagattatgcatctccaccatcaaaaacatcatcaaggatat
ataaataatttgaatgaagctttgaaaagcttggatgtagcaagtgctactcaggatctc
acgggattaatcgcaattaacccagctttgcgtttcaatggcggggggcatattaatcat
tcattgttttgggaaatgctagcgccacaaaacaaaggcggagggactccacctcgtcat
gagttgcttaagttaatagaaaaattttggggctctttcgacaattttttaaaaaatttt
attagttcttctgctgccgtacagggatccggctggggttggttggctttttgtcccaaa
aaacaagagcttatgatacagaccacagcaaaccaagatcctctagaggctacaacgggg
atgatacctctcctcggagtagatgtgtgggagcatgcgtactatctccagtataaaaat
gcaagattggattatttaaagaattttccaagtataattaactgggattatatagagagt
cgttttgtagaaatgagtaagtaa

DBGET integrated database retrieval system