KEGG   Chelonia mydas (green sea turtle): 102943137Help
Entry
102943137         CDS       T02989                                 

Gene name
CDC23
Definition
(RefSeq) cell division cycle 23
  KO
K03355  
anaphase-promoting complex subunit 8
Organism
cmy  Chelonia mydas (green sea turtle)
Pathway
Cell cycle
Oocyte meiosis
Ubiquitin mediated proteolysis
Progesterone-mediated oocyte maturation
Module
APC/C complex
Brite
KEGG Orthology (KO) [BR:cmy00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    102943137 (CDC23)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    102943137 (CDC23)
   04114 Oocyte meiosis
    102943137 (CDC23)
 Organismal Systems
  Endocrine system
   04914 Progesterone-mediated oocyte maturation
    102943137 (CDC23)
Ubiquitin system [BR:cmy04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     102943137 (CDC23)
Chromosome [BR:cmy03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    102943137 (CDC23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
LinkDB All DBs
Position
Un
AA seq 589 aa AA seqDB search
MGKMAAPAVVPGLGSCDFSDLREIKKQLLSVAERSRERGLQHSGKWASELAFALDPLPLS
ELPAAPALTEEDARDLDAYTLAKSYFDLKEYDRAAYFLRGCKSQKAYFLYMYSRYLSGEK
KKDDETVDSLGPLEKGQVKNEALRELRVELSKKHKAQELDGFGLYLYGVVLRKLDLVKEA
IDVFVEAAHVLPLHWGAWLELCNLITDKEMLKCLSLPDTWMKEFFLAHIYTELQLIEEAL
QKYQSLIDAGFSKSTYIISQIAVAYHNIRDIDKALSIFNELRKQDPYRIENMDTFSNLLY
VRSMKPELSYLAHNLCEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKLNPRYLGAW
TLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLYYYRRAHQL
RPNDSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQLNESEQAAQ
CYIKYIQDIYSCGEIVEHLEVSTAFRYLAQYYFKCKLWDEASACAQKCCAFNDTREEGKA
LLRQILQLRNQGETSSTEISAPFFLPASLSSNNTPTRRVSPLNLSSVTP
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgggcaagatggcggctcctgccgttgtgcccggtttgggaagctgcgatttctccgac
ttgcgcgagatcaagaagcagcttctgagcgtggcggagcggagccgcgagcgtggcctg
cagcacagcgggaaatgggcctctgagctggcgtttgccctggatcctctgcctctgagc
gagctgcctgcggctcctgcgctcacagaggaggatgctcgtgatttggatgcttacaca
ttagctaagtcttatttcgatctgaaggagtatgacagggccgcatactttctgcgggga
tgcaagagccagaaggcctacttcttgtacatgtactccagatacctgtcaggagaaaag
aagaaagatgatgaaacagtggatagtctgggccccttggagaaaggacaggtgaagaat
gaagcactaagagagctaagggtggagcttagcaaaaaacacaaagcacaggagctggat
ggttttggcctttatctgtatggcgttgtgctgcggaagctggacctggtgaaagaggcc
attgatgtgtttgttgaagctgcccatgttttgcctttgcactggggagcctggctggag
ctctgtaatctgatcacagacaaagagatgctgaagtgcctgtccttgccagacacctgg
atgaaggagttcttcctggcgcacatttacacagagctgcagctgatagaagaggctctg
cagaagtaccagagtctcattgatgcaggattctccaagagcacctacatcatttcccag
atcgcagttgcctaccacaatatcagagatatagacaaagctctctctatcttcaatgaa
ctaaggaaacaagacccatacaggatagaaaacatggacaccttctccaacctgctgtat
gtccggagcatgaagcctgagctgagctacctggctcacaatctgtgtgagattgacaag
tatcgtgtggagacctgctgtgtgataggaaattactatagtctacgctctcagcatgaa
aaagcagcactttatttccagagagccttgaaactgaatcctcggtatcttggagcctgg
accctcatgggacatgagtacatggaaatgaagaacacatctgcagctatccaggcttat
agacatgcaatagaggtgaacaagagggactacagagcctggtatggactggggcaaacc
tatgagatcctcaagatgccattttactgtctgtattactaccgacgggcccaccagctg
aggcccaatgattcccgtatgctggttgctctgggagagtgttatgagaaactcaatcag
ctggtggaagccaaaaagtgttattggagagcttatgctgtgggagatgtggagaaaatg
gcattggtgaaactagccaagctgcatgaacagctgaatgaatcagaacaggctgctcag
tgctacatcaaatacatccaggatatctattcctgtggggagatagtggagcacctggag
gtgagcactgccttccgctacctagcccagtattacttcaagtgtaaactctgggatgaa
gcctctgcctgtgctcagaaatgctgtgcattcaatgatacaagagaagaagggaaggcc
ctgctgagacagattttacaactacgcaaccaaggggaaacctcctctacagagatctct
gctcccttcttcctccctgcatcgctgtcatccaacaacactcccacacggagagtatcc
ccactcaacctgtcttcagttacaccatga

DBGET integrated database retrieval system